SitesBLAST
Comparing H281DRAFT_01572 FitnessBrowser__Burk376:H281DRAFT_01572 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8hw0A The structure of akr6d1
32% identity, 98% coverage: 1:331/339 of query aligns to 1:329/329 of 8hw0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), W21 (vs. gap), Q27 (≠ G26), D49 (= D57), Y54 (= Y62), R123 (≠ D132), S152 (≠ C161), Q178 (= Q187), W207 (= W215), S208 (= S216), P209 (= P217), L210 (= L218), S212 (≠ G220), K218 (= K226), S227 (≠ A238), R228 (≠ K239), I285 (= I286), G287 (= G288), S289 (≠ R290), Q293 (= Q294), D296 (≠ A297), N297 (= N298)
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 96% coverage: 1:325/339 of query aligns to 1:317/331 of P80874
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
32% identity, 96% coverage: 1:325/339 of query aligns to 1:317/333 of 1pz1A
- active site: D52 (= D57), Y57 (= Y62), K90 (≠ G96), Q93 (= Q99), H125 (= H131)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), W21 (≠ F23), Q175 (= Q187), Y203 (≠ W215), G204 (≠ S216), L206 (= L218), R208 (≠ G220), K214 (= K226), G280 (= G288), R282 (= R290), Q286 (= Q294)
P63144 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Rattus norvegicus (Rat) (see paper)
31% identity, 94% coverage: 1:317/339 of query aligns to 71:388/401 of P63144
- K152 (= K90) mutation to M: Loss of enzyme activity.
Q14722 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Homo sapiens (Human) (see paper)
32% identity, 89% coverage: 1:301/339 of query aligns to 89:388/419 of Q14722
- Y307 (= Y227) mutation to F: Reduces affinity for NADPH.
- R316 (= R237) mutation to E: Nearly abolishes NADPH binding.
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
31% identity, 95% coverage: 1:322/339 of query aligns to 1:320/323 of 6ow0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G31), L21 (≠ I33), D49 (= D57), Y54 (= Y62), S151 (≠ C161), Y204 (≠ W215), F205 (≠ S216), L207 (= L218), Q209 (≠ G220), G210 (= G221), T213 (≠ S224), K215 (= K226), R227 (≠ Q229), V284 (≠ I286), G286 (= G288), Q292 (= Q294), N296 (= N298)
3eauA Voltage-dependent k+ channel beta subunit in complex with cortisone (see paper)
30% identity, 88% coverage: 3:301/339 of query aligns to 5:302/327 of 3eauA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G19), W23 (vs. gap), Q29 (≠ G26), D51 (= D57), Y56 (= Y62), K84 (= K90), S154 (≠ C161), Q180 (= Q187), W209 (= W215), S210 (= S216), P211 (= P217), L212 (= L218), A213 (= A219), C214 (≠ G220), G215 (= G221), K220 (= K226), R230 (= R237), L287 (≠ I286), L288 (≠ V287), G289 (= G288), S291 (≠ R290), Q295 (= Q294), E298 (≠ A297), N299 (= N298)
- binding 17,21-dihydroxypregna-1,4-diene-3,11,20-trione: W23 (vs. gap), V55 (≠ A61), Y56 (= Y62), W87 (≠ R94), N124 (≠ H131), R155 (≠ N162), I174 (≠ A181), I177 (≠ V184), I202 (≠ N208)
1exbA Structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels (see paper)
30% identity, 88% coverage: 3:301/339 of query aligns to 4:301/326 of 1exbA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G19), W22 (vs. gap), Q28 (≠ G26), D50 (= D57), Y55 (= Y62), S153 (≠ C161), R154 (≠ N162), Q179 (= Q187), W208 (= W215), S209 (= S216), P210 (= P217), L211 (= L218), C213 (≠ G220), G214 (= G221), S217 (= S224), K219 (= K226), S228 (≠ R236), R229 (= R237), L286 (≠ I286), G288 (= G288), S290 (≠ R290), Q294 (= Q294), E297 (≠ A297), N298 (= N298)
P62483 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; EC 1.1.1.- from Rattus norvegicus (Rat) (see 11 papers)
30% identity, 88% coverage: 3:301/339 of query aligns to 39:336/367 of P62483
- T56 (≠ A20) binding
- W57 (vs. gap) binding
- Q63 (≠ G26) binding
- D85 (= D57) binding
- Y90 (= Y62) mutation to F: Abolishes enzyme activity, but has no effect on NADPH binding.
- S112 (≠ R84) modified: Phosphoserine
- N158 (≠ H131) binding
- S188 (≠ C161) binding
- R189 (≠ N162) binding
- Q214 (= Q187) binding
- W243 (= W215) binding
- S244 (= S216) binding
- P245 (= P217) binding
- L246 (= L218) binding
- A247 (= A219) binding
- C248 (≠ G220) binding
- K254 (= K226) binding
- Y262 (≠ G235) binding
- R264 (= R237) binding
- G323 (= G288) binding
- S325 (≠ R290) binding
- Q329 (= Q294) binding
- E332 (≠ A297) binding
- N333 (= N298) binding
Sites not aligning to the query:
- 9 modified: Phosphoserine; S→A: Impairs interaction with MAPRE1 and association with microtubules.
- 20 modified: Phosphoserine; S→A: No effect on interaction with MAPRE1 and association with microtubules.
- 31 S→A: Impairs interaction with MAPRE1 and association with microtubules.
P62482 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; Neuroimmune protein F5; EC 1.1.1.- from Mus musculus (Mouse) (see 2 papers)
30% identity, 88% coverage: 3:301/339 of query aligns to 39:336/367 of P62482
- Y90 (= Y62) mutation to F: No detectable phenotype.
- S112 (≠ R84) modified: Phosphoserine
Sites not aligning to the query:
- 20 modified: Phosphoserine
7wf3C Composite map of human kv1.3 channel in apo state with beta subunits (see paper)
29% identity, 88% coverage: 3:301/339 of query aligns to 6:303/328 of 7wf3C
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G19), R156 (≠ N162), W210 (= W215), S211 (= S216), P212 (= P217), L213 (= L218), C215 (≠ G220), K221 (= K226), R231 (= R237), Q296 (= Q294), E299 (≠ A297), N300 (= N298)
Q13303 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; hKvbeta2; EC 1.1.1.- from Homo sapiens (Human) (see 2 papers)
29% identity, 88% coverage: 3:301/339 of query aligns to 39:336/367 of Q13303
- T56 (≠ A20) binding
- W57 (vs. gap) binding
- Q63 (≠ G26) binding
- D85 (= D57) binding
- Y90 (= Y62) mutation to F: No effect on its activity in promoting KCNA4 channel closure.
- S112 (≠ R84) modified: Phosphoserine
- S188 (≠ C161) binding
- R189 (≠ N162) binding
- Q214 (= Q187) binding
- W243 (= W215) binding
- S244 (= S216) binding
- P245 (= P217) binding
- L246 (= L218) binding
- A247 (= A219) binding
- C248 (≠ G220) binding
- K254 (= K226) binding
- R264 (= R237) binding
- S325 (≠ R290) binding
- Q329 (= Q294) binding
- E332 (≠ A297) binding
- N333 (= N298) binding
Sites not aligning to the query:
- 31 modified: Phosphoserine
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
32% identity, 95% coverage: 1:322/339 of query aligns to 1:296/301 of 6ow0B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), L21 (≠ M21), Y50 (= Y62), H117 (= H131), S147 (≠ C161), Y200 (≠ W215), F201 (≠ S216), L203 (= L218), Q205 (≠ G220), T209 (≠ S224), Q268 (= Q294), N272 (= N298)
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
30% identity, 94% coverage: 4:320/339 of query aligns to 3:310/311 of 1pz0A
- active site: D52 (= D57), Y57 (= Y62), N91 (≠ G98), H124 (= H131)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H124 (= H131), Q174 (= Q187), Y202 (≠ W215), F203 (≠ S216), P204 (= P217), L205 (= L218), S207 (≠ G220), G208 (= G221), A211 (≠ S224), K213 (= K226)
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
30% identity, 94% coverage: 1:317/339 of query aligns to 1:308/310 of P46336
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 95% coverage: 3:325/339 of query aligns to 9:346/351 of Q9P7U2
- S113 (vs. gap) modified: Phosphoserine
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
29% identity, 93% coverage: 1:316/339 of query aligns to 11:319/335 of 4aubB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G19), W31 (= W30), D59 (= D57), Y64 (= Y62), H136 (= H131), Q191 (= Q187), F220 (≠ W215), T221 (≠ S216), P222 (= P217), L223 (= L218), Q225 (≠ G220), G226 (= G221), K231 (= K226), R241 (≠ K239), R244 (≠ F242), L288 (≠ I286), G290 (= G288), S292 (≠ R290), Q296 (= Q294), E299 (≠ A297), N300 (= N298)
Sites not aligning to the query:
1lqaA Tas protein from escherichia coli in complex with NADPH (see paper)
30% identity, 94% coverage: 1:319/339 of query aligns to 1:339/346 of 1lqaA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), M21 (= M21), D48 (= D57), Y53 (= Y62), H132 (= H131), N180 (= N162), Q205 (= Q187), Y233 (≠ W215), S234 (= S216), L236 (= L218), F238 (≠ G220), G239 (= G221), T242 (≠ S224), K244 (= K226), A254 (≠ R236), R255 (= R237), G308 (= G288), T310 (≠ R290), Q314 (= Q294), N318 (= N298)
P0A9T4 Protein tas from Escherichia coli (strain K12) (see paper)
30% identity, 94% coverage: 1:319/339 of query aligns to 1:339/346 of P0A9T4
- 234:244 (vs. 216:226, 55% identical) binding
6hg6A Clostridium beijerinckii aldo-keto reductase cbei_3974 with NADPH (see paper)
29% identity, 94% coverage: 1:318/339 of query aligns to 12:311/313 of 6hg6A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G30 (= G19), W32 (= W30), D60 (= D57), Y65 (= Y62), H137 (= H131), Q192 (= Q187), F221 (≠ W215), S222 (= S216), P223 (= P217), L224 (= L218), L278 (≠ I286), I279 (≠ V287), G280 (= G288), Q286 (= Q294), E289 (≠ A297), N290 (= N298)
Query Sequence
>H281DRAFT_01572 FitnessBrowser__Burk376:H281DRAFT_01572
MEYSMLGRTGLRVSRLSLGAMTFGAGSGIWGSIAGLNSDQAARLVAMAVERGVNLIDTAD
AYSQGRSEEVVGHVLKALGLDEDRMLVATKVRLRTGTGQNEVGLGRSHIMRSVETSLKRL
GRDHIDLFQLHDRDALVPLDETLRVLDDLVTQGKVRHIGVCNFSAGDLERAVGITSRTDR
AHVVSNQVHYSLTSRDIEHEIMPVAATNRIGLFVWSPLAGGYLSGKYSQNGGAAGRRAKL
DFPPVDTVRAEPILAVLREVARELAATPAQVSLGWLLAREQITSVIVGARTCEQLAANLD
AQNLALTSEQCARLDKVSEPSVPFPYWMQRFHDRDRVVG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory