Comparing H281DRAFT_01585 H281DRAFT_01585 amino acid/amide ABC transporter ATP-binding protein 2, HAAT family to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
46% identity, 100% coverage: 1:237/237 of query aligns to 2:239/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 97% coverage: 5:235/237 of query aligns to 2:234/240 of 6mjpA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
34% identity, 94% coverage: 13:235/237 of query aligns to 11:234/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
34% identity, 94% coverage: 13:235/237 of query aligns to 11:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
34% identity, 94% coverage: 13:235/237 of query aligns to 11:234/234 of 4p31A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
34% identity, 94% coverage: 13:235/237 of query aligns to 11:234/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
34% identity, 94% coverage: 13:235/237 of query aligns to 11:234/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
33% identity, 94% coverage: 13:235/237 of query aligns to 12:235/241 of 6mbnA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
33% identity, 94% coverage: 13:234/237 of query aligns to 11:233/233 of 6b8bA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 91% coverage: 5:219/237 of query aligns to 4:232/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 91% coverage: 5:219/237 of query aligns to 4:232/253 of 1g9xB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 98% coverage: 4:236/237 of query aligns to 1:237/241 of 4u00A
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
32% identity, 82% coverage: 23:216/237 of query aligns to 3828:4021/5034 of Q5SSE9
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 98% coverage: 5:236/237 of query aligns to 1:237/240 of 4ymuJ
8ee6A Cryo-em structure of human abca7 in pe/ch nanodiscs (see paper)
32% identity, 80% coverage: 31:220/237 of query aligns to 1525:1713/1808 of 8ee6A
Sites not aligning to the query:
P55339 ABC-type transporter ATP-binding protein EcsA from Bacillus subtilis (strain 168) (see paper)
31% identity, 98% coverage: 5:236/237 of query aligns to 3:233/247 of P55339
Q9BZC7 ATP-binding cassette sub-family A member 2; ATP-binding cassette transporter 2; ATP-binding cassette 2; EC 7.6.2.- from Homo sapiens (Human) (see paper)
28% identity, 93% coverage: 5:224/237 of query aligns to 2049:2272/2435 of Q9BZC7
Sites not aligning to the query:
8eopA Cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state (see paper)
31% identity, 80% coverage: 31:220/237 of query aligns to 1479:1667/1687 of 8eopA
Sites not aligning to the query:
E9Q876 Glucosylceramide transporter ABCA12; ATP-binding cassette sub-family A member 12; EC 7.6.2.1 from Mus musculus (Mouse) (see 2 papers)
30% identity, 89% coverage: 10:220/237 of query aligns to 1350:1560/2595 of E9Q876
Sites not aligning to the query:
8f5bA Human abca4 structure in complex with amp-pnp
31% identity, 80% coverage: 32:220/237 of query aligns to 749:935/1924 of 8f5bA
Sites not aligning to the query:
>H281DRAFT_01585 H281DRAFT_01585 amino acid/amide ABC transporter ATP-binding protein 2, HAAT family
MSEPMLKVAGLNAFYGRAHILFDVGLEVGRGEVVALMGRNGAGKSTTMKAVMGLLPRRQG
EVIFRGQNIAALAPYKIARMGMGFVPEDRRVFADLTVMENLDTGRQPPREGAPQWTPEKL
FRLFPNLGEMPKRPGGQMSGGEQQMLTVSRTLMGNPYLVLLDEPSEGVAPVIVEQMANMI
LELKREGLSILLSEQNLHFAELVSDRAYVLEKGQIRFSGTIGELASNETVRRAYLSV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory