Comparing H281DRAFT_01594 FitnessBrowser__Burk376:H281DRAFT_01594 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
91% identity, 99% coverage: 1:261/263 of query aligns to 1:261/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 98% coverage: 1:259/263 of query aligns to 1:263/268 of 6eb3B
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
29% identity, 89% coverage: 26:259/263 of query aligns to 28:267/278 of 4uhfA
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
29% identity, 89% coverage: 26:259/263 of query aligns to 28:267/272 of 4uheA
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 98% coverage: 1:259/263 of query aligns to 1:260/265 of 6eb3A
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
29% identity, 89% coverage: 26:259/263 of query aligns to 28:267/274 of 4uhdA
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 98% coverage: 1:259/263 of query aligns to 1:257/262 of 6eb3C
Q86WA6 Valacyclovir hydrolase; VACVase; Valacyclovirase; Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Breast epithelial mucin-associated antigen; MCNAA; EC 3.1.-.- from Homo sapiens (Human) (see 2 papers)
25% identity, 97% coverage: 5:259/263 of query aligns to 45:290/291 of Q86WA6
Sites not aligning to the query:
2ociA Crystal structure of valacyclovir hydrolase complexed with a product analogue (see paper)
25% identity, 97% coverage: 5:259/263 of query aligns to 8:253/254 of 2ociA
2ocgA Crystal structure of human valacyclovir hydrolase (see paper)
25% identity, 97% coverage: 5:259/263 of query aligns to 8:253/254 of 2ocgA
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
27% identity, 92% coverage: 20:261/263 of query aligns to 30:270/271 of 2d0dA
1ukaA Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate (see paper)
27% identity, 92% coverage: 20:261/263 of query aligns to 30:270/271 of 1ukaA
1uk9A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate (see paper)
27% identity, 92% coverage: 20:261/263 of query aligns to 30:270/271 of 1uk9A
1uk8A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate (see paper)
27% identity, 92% coverage: 20:261/263 of query aligns to 30:270/271 of 1uk8A
1uk7A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-butyrate (see paper)
27% identity, 92% coverage: 20:261/263 of query aligns to 30:270/271 of 1uk7A
1iupA Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates (see paper)
27% identity, 92% coverage: 20:261/263 of query aligns to 30:270/271 of 1iupA
1iunB Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal (see paper)
27% identity, 92% coverage: 20:261/263 of query aligns to 31:271/276 of 1iunB
3heaA The l29p/l124i mutation of pseudomonas fluorescens esterase (see paper)
24% identity, 98% coverage: 3:259/263 of query aligns to 3:269/271 of 3heaA
3hi4A Switching catalysis from hydrolysis to perhydrolysis in p. Fluorescens esterase (see paper)
24% identity, 98% coverage: 3:259/263 of query aligns to 3:269/271 of 3hi4A
8pi1B Bicyclic incypro pseudomonas fluorescens esterase (see paper)
25% identity, 98% coverage: 3:259/263 of query aligns to 3:269/276 of 8pi1B
Sites not aligning to the query:
>H281DRAFT_01594 FitnessBrowser__Burk376:H281DRAFT_01594
MPYAAVNGTELHYRIDGDRHGNAPWIVLSNSLGSDLSMWTPQVAALSKHFRVLRYDTRGH
GHSEAPKGPYTIEQLSGDVLGLMDTLKIARANFCGVSMGGLTGVALAARHANRFERVVLA
NTAARIGSPEVWVPRAARARTEGMLALSDAVLPRWFTADYIEREPVVLAMIRDVFVHTDK
EGYASNCDAIDATDLRPETHGIKLPVLVISGTHDVAATPAQGRELAQAIPGARYVELDAS
HISNIEKADAFTKTVIDFLTEPK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory