Comparing H281DRAFT_01622 FitnessBrowser__Burk376:H281DRAFT_01622 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
52% identity, 55% coverage: 119:286/308 of query aligns to 94:252/280 of 7bw9A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
37% identity, 84% coverage: 35:292/308 of query aligns to 27:266/267 of 3q1xA
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
37% identity, 84% coverage: 35:292/308 of query aligns to 29:268/270 of 3p47A
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
37% identity, 66% coverage: 86:288/308 of query aligns to 38:231/243 of 4n69A
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
36% identity, 66% coverage: 86:288/308 of query aligns to 34:221/233 of 4n6bA
Sites not aligning to the query:
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
35% identity, 59% coverage: 111:292/308 of query aligns to 65:237/261 of 6wyeA
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
38% identity, 57% coverage: 112:288/308 of query aligns to 65:232/262 of 1t3dA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
35% identity, 59% coverage: 111:292/308 of query aligns to 63:235/243 of 7ra4A
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
37% identity, 57% coverage: 112:288/308 of query aligns to 61:228/258 of 8i04A
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
37% identity, 57% coverage: 112:288/308 of query aligns to 64:231/246 of 8i09A
Sites not aligning to the query:
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
36% identity, 59% coverage: 112:293/308 of query aligns to 65:237/244 of 8i06A
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
37% identity, 56% coverage: 122:293/308 of query aligns to 71:233/258 of 4h7oA
Sites not aligning to the query:
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
35% identity, 59% coverage: 112:293/308 of query aligns to 61:237/250 of 4hzdA
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
39% identity, 51% coverage: 131:287/308 of query aligns to 87:234/272 of 3gvdI
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
35% identity, 63% coverage: 102:296/308 of query aligns to 55:244/257 of 1ssqD
1sstA Serine acetyltransferase- complex with coa (see paper)
35% identity, 60% coverage: 102:287/308 of query aligns to 55:220/233 of 1sstA
Sites not aligning to the query:
>H281DRAFT_01622 FitnessBrowser__Burk376:H281DRAFT_01622
MPNAPTHNWGLEQIVADLRASREELHRTRHPLGIRELPSREAVVNIVAGLRAALFPTHYG
APDLTDETVDYYVGHTLESTLRLLAEQIRRALRFLPEHAQTPDTELRERAFEVARQFGTQ
LPGIRALLVSDIQAAFTGDPAAQHITEILLCYPGVWAMTHHRLAHALHRLGVPLLARFIN
EIAHSATGIDIHPGATIGPSFFIDHGTGVVIGETAIIGEHVRVYQAVTLGAKSFAADIDG
ALIKGNARHPIVEDDVVIYAGATILGRVTIGRGSVIGGNVWLTHSVPPGSSVSQGKVREG
ERGEEGRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory