Comparing H281DRAFT_01643 FitnessBrowser__Burk376:H281DRAFT_01643 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5umhB Crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
83% identity, 99% coverage: 3:312/312 of query aligns to 1:310/310 of 5umhB
5vxtB Crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria
82% identity, 99% coverage: 2:310/312 of query aligns to 5:311/312 of 5vxtB
5td3A Crystal structure of catechol 1,2-dioxygenase from burkholderia vietnamiensis
80% identity, 98% coverage: 4:309/312 of query aligns to 1:306/307 of 5td3A
P07773 Catechol 1,2-dioxygenase; 1,2-CTD; EC 1.13.11.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
57% identity, 99% coverage: 2:309/312 of query aligns to 1:310/311 of P07773
1dmhA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound 4-methylcatechol (see paper)
57% identity, 98% coverage: 4:309/312 of query aligns to 1:308/309 of 1dmhA
1dltA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound catechol (see paper)
57% identity, 98% coverage: 4:309/312 of query aligns to 1:308/309 of 1dltA
1dlmA Structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data (see paper)
57% identity, 98% coverage: 4:309/312 of query aligns to 1:308/309 of 1dlmA
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
50% identity, 92% coverage: 4:291/312 of query aligns to 1:288/309 of 2azqA
2xsrA Crystal structure of wild type acinetobacter radioresistens catechol 1,2 dioxygenase (see paper)
52% identity, 95% coverage: 14:310/312 of query aligns to 10:309/309 of 2xsrA
3th1A Crystal structure of chlorocatechol 1,2-dioxygenase from pseudomonas putida
37% identity, 80% coverage: 28:277/312 of query aligns to 2:240/246 of 3th1A
3o6rA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
32% identity, 82% coverage: 35:291/312 of query aligns to 1:253/256 of 3o6rA
3o6jA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with hydroxyquinol (see paper)
32% identity, 82% coverage: 35:291/312 of query aligns to 1:253/256 of 3o6jA
3o32A Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
32% identity, 82% coverage: 35:291/312 of query aligns to 1:253/256 of 3o32A
3n9tA Cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
33% identity, 75% coverage: 28:262/312 of query aligns to 21:251/286 of 3n9tA
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
33% identity, 87% coverage: 24:293/312 of query aligns to 3:255/256 of 3i51A
3i4yA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
33% identity, 87% coverage: 24:293/312 of query aligns to 3:255/256 of 3i4yA
3i4vA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol (see paper)
33% identity, 87% coverage: 24:293/312 of query aligns to 3:255/256 of 3i4vA
3hjsA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol (see paper)
33% identity, 87% coverage: 24:293/312 of query aligns to 3:255/256 of 3hjsA
3hjqA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol (see paper)
33% identity, 87% coverage: 24:293/312 of query aligns to 3:255/256 of 3hjqA
3hhyA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol (see paper)
33% identity, 87% coverage: 24:293/312 of query aligns to 3:255/256 of 3hhyA
>H281DRAFT_01643 FitnessBrowser__Burk376:H281DRAFT_01643
MMNVKVFATQEVQDLLKAAANLDSDKGDARTKQIAHRLLSDLFKAIDDLDITPDETWAGV
NYLNKLGQDGEAALLAAGLGLEKYLDIRMDAEDRQAEIDGGTPRTIEGPLYVEGAPVRDG
VSKIDLDADADAGPLVIRGTVRGPDGKPVAGAVVECWHANSKGFYSHFDPTGAQSPFNLR
GAVRTQDDGTYEFRTLMPVGYGCPPQGATQQLLNVLARHGNRPAHVHFFVKADGLRKLTT
QINIEGDPLIWDDFAYATREDLIPPVVGKSGGAALGLKDDAYKEIEFNFTLTPLVEGKDN
QLVNRLRTAAAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory