SitesBLAST
Comparing H281DRAFT_01645 FitnessBrowser__Burk376:H281DRAFT_01645 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1f9cA Crystal structure of mle d178n variant (see paper)
55% identity, 97% coverage: 3:370/378 of query aligns to 1:360/360 of 1f9cA
- active site: T41 (= T53), G44 (= G56), T129 (= T141), K155 (= K167), K157 (= K169), D186 (= D198), N188 (= N200), E212 (= E224), D237 (= D247), E238 (= E248), S239 (≠ I249), K261 (= K271), G288 (= G298), T289 (= T299), M290 (= M300), T314 (= T324), E315 (= E325), L316 (= L326)
- binding manganese (ii) ion: D186 (= D198), E212 (= E224), D237 (= D247)
3dgbA Crystal structure of muconate lactonizing enzyme from pseudomonas fluorescens complexed with muconolactone (see paper)
56% identity, 97% coverage: 4:370/378 of query aligns to 3:371/371 of 3dgbA
- active site: H21 (= H22), T52 (= T53), G55 (= G56), T140 (= T141), K166 (= K167), K168 (= K169), D197 (= D198), N199 (= N200), E223 (= E224), D248 (= D247), E249 (= E248), S250 (≠ I249), I251 (≠ L250), K272 (= K271), Y297 (= Y296), G299 (= G298), T300 (= T299), M301 (= M300), H313 (= H312), T325 (= T324), E326 (= E325), L327 (= L326)
- binding magnesium ion: D197 (= D198), E223 (= E224), D248 (= D247)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: I53 (= I54), Y58 (= Y59), T140 (= T141), K166 (= K167), K168 (= K169), D197 (= D198), K272 (= K271), T300 (= T299), E326 (= E325), F328 (= F327)
3fcpA Crystal structure of muconate lactonizing enzyme from klebsiella pneumoniae
47% identity, 97% coverage: 3:370/378 of query aligns to 2:355/356 of 3fcpA
- active site: T41 (= T53), G44 (= G56), T129 (= T141), K151 (= K167), K153 (= K169), D182 (= D198), N184 (= N200), E208 (= E224), D233 (= D247), E234 (= E248), A235 (≠ I249), K257 (= K271), G284 (= G298), T285 (= T299), M286 (= M300), T309 (= T324), E310 (= E325), M311 (≠ L326)
- binding magnesium ion: N184 (= N200), D233 (= D247), E234 (= E248)
1nu5A Crystal structure of pseudomonas sp. P51 chloromuconate lactonizing enzyme (see paper)
43% identity, 97% coverage: 6:370/378 of query aligns to 3:368/369 of 1nu5A
- active site: L19 (≠ H22), S49 (≠ T52), G52 (≠ A55), T137 (= T141), K163 (= K167), K165 (= K169), E176 (≠ A180), D194 (= D198), N196 (= N200), E220 (= E224), D245 (= D247), E246 (= E248), S247 (≠ I249), K269 (= K271), G296 (= G298), T297 (= T299), M298 (= M300), C322 (≠ T324), E323 (= E325), L324 (= L326)
- binding manganese (ii) ion: D194 (= D198), E220 (= E224), T235 (≠ M237), N238 (≠ F240), D245 (= D247)
2chrA A re-evaluation of the crystal structure of chloromuconate cycloisomerase (see paper)
42% identity, 97% coverage: 6:370/378 of query aligns to 3:368/370 of 2chrA
- active site: I19 (≠ H22), S49 (≠ T53), G52 (= G56), T137 (= T141), K163 (= K167), K165 (= K169), D194 (= D198), N196 (= N200), E220 (= E224), D245 (= D247), E246 (= E248), S247 (≠ I249), S267 (≠ A269), K269 (= K271), G296 (= G298), T297 (= T299), M298 (= M300), C322 (≠ T324), E323 (= E325), L324 (= L326)
- binding manganese (ii) ion: D194 (= D198), E220 (= E224), D245 (= D247)
3i4kA Crystal structure of muconate lactonizing enzyme from corynebacterium glutamicum
39% identity, 97% coverage: 5:370/378 of query aligns to 3:370/370 of 3i4kA
- active site: H20 (= H22), V51 (≠ T53), G54 (= G56), G87 (≠ Q89), A139 (≠ T141), K165 (= K167), K167 (= K169), D196 (= D198), N198 (= N200), E222 (= E224), D247 (= D247), E248 (= E248), S249 (≠ I249), A269 (= A269), K271 (= K271), T272 (≠ I272), A298 (≠ G298), T299 (= T299), S300 (≠ M300), T324 (= T324), E325 (= E325), L326 (= L326)
- binding magnesium ion: D196 (= D198), E222 (= E224), D247 (= D247)
4m0xA Crystal structure of 2-chloromuconate cycloisomerase from rhodococcus opacus 1cp (see paper)
42% identity, 97% coverage: 5:371/378 of query aligns to 2:369/369 of 4m0xA
- active site: T50 (= T53), G53 (= G56), A138 (≠ T141), K163 (= K167), K165 (= K169), D194 (= D198), N196 (= N200), E220 (= E224), D245 (= D247), E246 (= E248), S247 (≠ I249), A267 (= A269), K269 (= K271), A296 (≠ G298), A297 (≠ T299), T298 (≠ M300), C322 (≠ T324), E323 (= E325), L324 (= L326)
- binding manganese (ii) ion: D194 (= D198), E220 (= E224), D245 (= D247)
3my9A Crystal structure of a muconate cycloisomerase from azorhizobium caulinodans
34% identity, 96% coverage: 4:366/378 of query aligns to 4:351/357 of 3my9A
- active site: P44 (= P61), W45 (≠ E62), S124 (≠ T141), K149 (= K167), K151 (= K169), D180 (= D198), N182 (= N200), E206 (= E224), D231 (= D247), E232 (= E248), S233 (≠ I249), S253 (≠ A269), K255 (= K271), G282 (= G298), T283 (= T299), L284 (≠ M300), C308 (≠ T324), E309 (= E325), F310 (≠ L326)
- binding magnesium ion: E206 (= E224), A221 (≠ P241), L224 (= L244), D231 (= D247)
O34508 L-Ala-D/L-Glu epimerase; AE epimerase; AEE; EC 5.1.1.20 from Bacillus subtilis (strain 168) (see 2 papers)
31% identity, 93% coverage: 6:358/378 of query aligns to 3:354/366 of O34508
- R24 (≠ A27) binding
- T135 (= T141) binding
- K160 (= K167) binding
- K162 (= K169) active site, Proton acceptor; specific for (R)-substrate epimerization
- D191 (= D198) binding
- E219 (= E224) binding
- D244 (= D247) binding
- K268 (= K271) active site, Proton acceptor; specific for (S)-substrate epimerization
- S296 (≠ T299) binding
- I298 (≠ L301) binding
- D321 (≠ E325) binding
- D323 (≠ F327) binding
1tkkA The structure of a substrate-liganded complex of the l-ala-d/l-glu epimerase from bacillus subtilis (see paper)
31% identity, 93% coverage: 6:358/378 of query aligns to 3:354/359 of 1tkkA
- active site: F19 (≠ H22), P50 (≠ T53), V53 (≠ A58), T135 (= T141), K160 (= K167), K162 (= K169), L190 (≠ V197), D191 (= D198), A192 (≠ V199), N193 (= N200), E219 (= E224), D244 (= D247), E245 (= E248), S246 (≠ I249), N266 (≠ A269), K268 (= K271), G295 (= G298), S296 (≠ T299), M297 (= M300), F320 (≠ T324), D321 (≠ E325), F322 (≠ L326)
- binding alanine: K160 (= K167), K162 (= K169), D321 (≠ E325), D323 (≠ F327)
- binding glutamic acid: F19 (≠ H22), R24 (≠ A27), K160 (= K167), D191 (= D198), K268 (= K271), S296 (≠ T299), M297 (= M300), I298 (≠ L301)
- binding magnesium ion: D191 (= D198), E219 (= E224), D244 (= D247)
1jpmA L-ala-d/l-glu epimerase (see paper)
31% identity, 93% coverage: 6:358/378 of query aligns to 3:354/359 of 1jpmA
- active site: F19 (≠ H22), P50 (≠ T53), V53 (≠ A58), T135 (= T141), K160 (= K167), K162 (= K169), L190 (≠ V197), D191 (= D198), A192 (≠ V199), N193 (= N200), E219 (= E224), D244 (= D247), E245 (= E248), S246 (≠ I249), N266 (≠ A269), K268 (= K271), G295 (= G298), S296 (≠ T299), M297 (= M300), F320 (≠ T324), D321 (≠ E325), F322 (≠ L326)
- binding magnesium ion: D191 (= D198), E219 (= E224), D244 (= D247)
2p8cA Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 complexed with n-succinyl arg. (see paper)
29% identity, 96% coverage: 6:369/378 of query aligns to 3:362/369 of 2p8cA
- active site: F19 (≠ H22), A50 (= A55), H53 (≠ A58), V136 (≠ T141), F160 (= F166), K161 (= K167), M162 (≠ L168), K163 (= K169), D191 (= D198), N193 (= N200), E218 (= E224), D243 (= D247), E244 (= E248), G245 (≠ I249), N265 (≠ A269), K267 (= K271), G294 (= G298), S295 (≠ T299), M296 (= M300), V319 (≠ T324), E320 (= E325), L321 (= L326)
- binding magnesium ion: D191 (= D198), E218 (= E224), D243 (= D247)
- binding n~2~-(3-carboxypropanoyl)-l-arginine: F19 (≠ H22), Y26 (≠ M29), M29 (≠ Q32), D51 (≠ G56), K163 (= K169), D191 (= D198), D243 (= D247), K267 (= K271), S295 (≠ T299), M296 (= M300), E320 (= E325), L321 (= L326), T322 (≠ F327)
2p8bA Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 complexed with n-succinyl lys. (see paper)
29% identity, 96% coverage: 6:369/378 of query aligns to 3:362/369 of 2p8bA
- active site: F19 (≠ H22), A50 (= A55), H53 (≠ A58), V136 (≠ T141), F160 (= F166), K161 (= K167), M162 (≠ L168), K163 (= K169), D191 (= D198), N193 (= N200), E218 (= E224), D243 (= D247), E244 (= E248), G245 (≠ I249), N265 (≠ A269), K267 (= K271), G294 (= G298), S295 (≠ T299), M296 (= M300), V319 (≠ T324), E320 (= E325), L321 (= L326)
- binding magnesium ion: D191 (= D198), E218 (= E224), D243 (= D247)
- binding n-succinyl lysine: F19 (≠ H22), Y26 (≠ M29), D51 (≠ G56), V136 (≠ T141), K161 (= K167), K163 (= K169), D243 (= D247), K267 (= K271), S295 (≠ T299), M296 (= M300), E320 (= E325), L321 (= L326), T322 (≠ F327)
2p88A Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 (see paper)
29% identity, 96% coverage: 6:369/378 of query aligns to 3:362/369 of 2p88A
- active site: F19 (≠ H22), A50 (= A55), H53 (≠ A58), V136 (≠ T141), F160 (= F166), K161 (= K167), M162 (≠ L168), K163 (= K169), D191 (= D198), N193 (= N200), E218 (= E224), D243 (= D247), E244 (= E248), G245 (≠ I249), N265 (≠ A269), K267 (= K271), G294 (= G298), S295 (≠ T299), M296 (= M300), V319 (≠ T324), E320 (= E325), L321 (= L326)
- binding magnesium ion: D191 (= D198), E218 (= E224), D243 (= D247)
Q81IL5 N-succinyl-L-Arg/Lys racemase; N-succinyl amino acid racemase; NSAR; EC 5.1.1.- from Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) (see paper)
29% identity, 96% coverage: 6:369/378 of query aligns to 3:362/369 of Q81IL5
- D191 (= D198) binding
- E218 (= E224) binding
- D243 (= D247) binding
3i6eA Crystal structure of muconate lactonizing enzyme from ruegeria pomeroyi.
32% identity, 89% coverage: 34:368/378 of query aligns to 20:352/356 of 3i6eA
- active site: S124 (≠ T141), K149 (= K167), K151 (= K169), D179 (= D198), Y180 (≠ V199), N181 (= N200), Q182 (≠ M201), E205 (= E224), D230 (= D247), E231 (= E248), S232 (≠ I249), K254 (= K271), Y279 (= Y296), G281 (= G298), D282 (≠ T299), M283 (= M300), C307 (≠ T324), E308 (= E325), F309 (≠ L326)
- binding magnesium ion: D179 (= D198), E205 (= E224), D230 (= D247)
3i6tB Crystal structure of muconate cycloisomerase from jannaschia sp.
31% identity, 89% coverage: 34:368/378 of query aligns to 32:362/364 of 3i6tB
- active site: S136 (≠ T141), K161 (= K167), K163 (= K169), D191 (= D198), N193 (= N200), E217 (= E224), D242 (= D247), E243 (= E248), S262 (≠ A269), K264 (= K271), G291 (= G298), D292 (≠ T299), M293 (= M300), C317 (≠ T324), E318 (= E325), F319 (≠ L326)
- binding magnesium ion: D191 (= D198), E217 (= E224), D242 (= D247)
Sites not aligning to the query:
3dg6A Crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone (see paper)
28% identity, 94% coverage: 16:371/378 of query aligns to 13:366/366 of 3dg6A
- active site: L19 (≠ H22), P50 (≠ T53), R51 (≠ I54), M134 (≠ T141), K160 (= K167), K162 (= K169), D191 (= D198), N193 (= N200), E217 (= E224), D242 (= D247), E243 (= E248), S244 (≠ I249), K266 (= K271), G292 (= G298), N293 (≠ T299), Q294 (≠ M300), G319 (≠ T324), E320 (= E325), L321 (= L326)
- binding magnesium ion: D191 (= D198), E217 (= E224), D242 (= D247)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: F21 (≠ L24), T54 (≠ A58), M134 (≠ T141), K160 (= K167), K162 (= K169), D191 (= D198), N193 (= N200), D242 (= D247), K266 (= K271), N293 (≠ T299), Q294 (≠ M300), I295 (≠ L301)
Q8EMJ9 Galactarate dehydratase (D-threo-forming); GalrD; GalrD-II; EC 4.2.1.158 from Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) (see paper)
28% identity, 88% coverage: 35:368/378 of query aligns to 24:367/391 of Q8EMJ9
- H45 (≠ G56) mutation to Q: Loss of activity.
- Y90 (≠ I94) active site, Proton donor; mutation to F: 3550-fold reduction in catalytic efficiency.
- R162 (≠ K167) mutation to N: 17000-fold reduction in catalytic efficiency.
- Y164 (≠ K169) active site, Proton acceptor; mutation to F: Loss of activity.
3hpfA Crystal structure of the mutant y90f of divergent galactarate dehydratase from oceanobacillus iheyensis complexed with mg and galactarate (see paper)
28% identity, 88% coverage: 35:368/378 of query aligns to 24:367/387 of 3hpfA
- active site: D42 (≠ T53), H45 (≠ G56), F90 (≠ I94), P133 (≠ T141), R162 (≠ K167), Y164 (≠ K169), Y192 (≠ V197), D193 (= D198), F194 (≠ V199), M219 (≠ L222), E221 (= E224), S244 (≠ A243), E245 (= E248), H246 (≠ I249), S268 (≠ K271), G295 (= G298), T296 (= T299), T297 (≠ M300), S321 (≠ T324), D322 (≠ E325)
- binding D-galactaric acid: H45 (≠ G56), Y89 (= Y93), R162 (≠ K167), Y164 (≠ K169), D193 (= D198), H246 (≠ I249), T296 (= T299), T297 (≠ M300), Q298 (≠ L301)
- binding magnesium ion: D42 (≠ T53), H45 (≠ G56), D193 (= D198), E221 (= E224), H246 (≠ I249), T297 (≠ M300)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_01645 FitnessBrowser__Burk376:H281DRAFT_01645
MATATIERIETSLVDLPTIRPHKLSVATMHGQTLMLVKVFCSDGIVGIGEGTTIAGMAYG
PESPESMKLSIDTYLAPAAIGKDATRVQQLMAYIGKLVKVNSFAKSALETALLDAHGKRL
NVPVSELLGGRRRERLPIAWTLASGDTSRDIAEAERMLDARRHKVFKLKIGAKELKTDIA
HVAQIKRELGERGAVRVDVNMAWSETQAAWAIPALADAGCELVEQPVMSPAALGRLMRRF
PIALMADEILQGPESAFEIAKHHGADVFAVKIEQSGGLFAAQRVAAIADAAGIELYGGTM
LEGAFGTVASAHLFASFANLQWGTELFGPLLITEEILTQPLDYSDFELTVPSGPGLGIAL
DEARVKRFTRDGLIAVTR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory