Comparing H281DRAFT_01655 FitnessBrowser__Burk376:H281DRAFT_01655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q01468 2-hydroxymuconate tautomerase; 4-oxalocrotonate tautomerase; 4-OT; EC 5.3.2.6 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
36% identity, 48% coverage: 1:59/124 of query aligns to 1:59/63 of Q01468
5tigA Crystal structure of 4-oxalocrotonate tautomerase inactivated by brhpd (see paper)
34% identity, 47% coverage: 2:59/124 of query aligns to 1:58/62 of 5tigA
Sites not aligning to the query:
1bjpA Crystal structure of 4-oxalocrotonate tautomerase inactivated by 2- oxo-3-pentynoate at 2.4 angstroms resolution (see paper)
34% identity, 47% coverage: 2:59/124 of query aligns to 1:58/62 of 1bjpA
Sites not aligning to the query:
6bgnA Crystal structure of 4-oxalocrotonate tautomerase after incubation with 5-fluoro-2-hydroxy-2,4-pentadienoate (see paper)
34% identity, 47% coverage: 2:59/124 of query aligns to 1:58/59 of 6bgnA
6ghwC Substituting the prolines of 4-oxalocrotonate tautomerase with non- canonical analogue (2s)-3,4-dehydroproline (see paper)
36% identity, 45% coverage: 2:57/124 of query aligns to 1:56/57 of 6ghwC
5cloM Crystal structure of a 4-oxalocrotonate tautomerase mutant in complex with nitrostyrene at 2.3 angstrom (see paper)
36% identity, 45% coverage: 2:57/124 of query aligns to 1:56/57 of 5cloM
7ms8A Crystal structure of y103f mutant of cg10062 with a covalent intermediate of the hydration of acetylenecarboxylic acid (see paper)
26% identity, 85% coverage: 13:117/124 of query aligns to 13:117/146 of 7ms8A
Sites not aligning to the query:
P70994 2-hydroxymuconate tautomerase; (2Z,4E)-2-hydroxyhexa-2,4-dienedioate keto-enol isomerase; 4-oxalocrotonate tautomerase; 4-OT; EC 5.3.2.6 from Bacillus subtilis (strain 168) (see paper)
30% identity, 45% coverage: 1:56/124 of query aligns to 1:56/62 of P70994
>H281DRAFT_01655 FitnessBrowser__Burk376:H281DRAFT_01655
MPTLEVYLPQGHSDERKASLIQGLTQATVDAIGAPAESVRILLSELPVSHIGLGGKLTAA
ALPVIIAILIAGRTEAQKEALIAHLSETSASVLNVPLQSTRVMIKDIPSTDFGLGGKTAR
SLGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory