Comparing H281DRAFT_01662 FitnessBrowser__Burk376:H281DRAFT_01662 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
Q01468 2-hydroxymuconate tautomerase; 4-oxalocrotonate tautomerase; 4-OT; EC 5.3.2.6 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
31% identity, 77% coverage: 1:54/70 of query aligns to 1:54/63 of Q01468
>H281DRAFT_01662 FitnessBrowser__Burk376:H281DRAFT_01662
MPIIHISLVEGRDAQAVKACLKAIARTVHETLGVPLDSIRVFANEVPSTHWAIGERTKDE
LGAPALENGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory