SitesBLAST
Comparing H281DRAFT_01665 H281DRAFT_01665 acetaldehyde dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
1nvmB Crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate (see paper)
71% identity, 97% coverage: 1:309/320 of query aligns to 1:312/312 of 1nvmB
- binding nicotinamide-adenine-dinucleotide: I10 (= I10), G11 (= G11), S12 (≠ P12), G13 (= G13), N14 (= N14), I15 (= I15), G37 (= G37), I38 (≠ V38), A78 (= A78), T79 (= T79), L103 (= L101), T104 (= T102), C132 (= C129), G165 (= G162), P166 (= P163), G167 (= G164), T168 (= T165), N171 (= N168), N290 (= N287), L291 (= L288), M294 (= M291)
Q52060 Acetaldehyde dehydrogenase; Acetaldehyde dehydrogenase [acetylating]; EC 1.2.1.10 from Pseudomonas sp. (strain CF600) (see paper)
71% identity, 97% coverage: 1:309/320 of query aligns to 1:312/312 of Q52060
- SGNI 12:15 (≠ PGNI 12:15) binding
- 163:171 (vs. 160:168, 100% identical) binding
- N290 (= N287) binding
4lrsB Crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and coa accommodation whithin the shared cofactor-binding site
56% identity, 94% coverage: 4:304/320 of query aligns to 2:292/294 of 4lrsB
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), P10 (= P12), G11 (= G13), N12 (= N14), I13 (= I15), V35 (= V38), A73 (= A78), T74 (= T79), L96 (= L101), T97 (= T102), C125 (= C129), G158 (= G162), P159 (= P163), G160 (= G164), T161 (= T165), N164 (= N168), N275 (= N287), L276 (= L288), M279 (= M291)
4lrtB Crystal and solution structures of the bifunctional enzyme (aldolase/aldehyde dehydrogenase) from thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and coa accommodation whithin the shared cofactor-binding site
56% identity, 94% coverage: 4:304/320 of query aligns to 4:294/295 of 4lrtB
- binding coenzyme a: G11 (= G11), P12 (= P12), G13 (= G13), N14 (= N14), I15 (= I15), G36 (= G37), V37 (= V38), S41 (= S42), A75 (= A78), T76 (= T79), C127 (= C129), T163 (= T165), N277 (= N287), L278 (= L288)
Q79AF6 Acetaldehyde dehydrogenase 4; Acetaldehyde dehydrogenase [acetylating] 4; Propanal dehydrogenase (CoA-propanoylating); EC 1.2.1.10; EC 1.2.1.87 from Paraburkholderia xenovorans (strain LB400) (see 2 papers)
54% identity, 96% coverage: 1:308/320 of query aligns to 1:294/304 of Q79AF6
- C131 (= C129) active site, Acyl-thioester intermediate; mutation C->A,S: Loss of catalytic activity. Still able to bind NAD(+), however with much lower affinity.
- N170 (= N168) mutation N->A,D: Displays significant reduction in the level of allosteric activation of the aldol cleavage reaction by BphI.
- I171 (= I169) mutation I->A,F: Exhibits preferences for aldehydes similar as wild-type. Exhibits about 80% of wild-type acetaldehyde channeling efficiency. Displays significant reduction in the level of allosteric activation of the aldol cleavage reaction by BphI.
- I195 (= I193) mutation to A: 5-fold decrease in affinity for acetaldehyde. Increase in affinity for butyraldehyde and pentaldehyde, leading to a 9- and 20-fold increase in catalytic efficiency with butyraldehyde and pentaldehyde as substrate, respectively. Exhibits 84% of wild-type acetaldehyde channeling efficiency.; mutation to F: 4- to 7-fold decrease in catalytic efficiency with aldehydes three to four carbons in length. Does not significantly reduce the channeling efficiency of the enzyme complex toward acetaldehyde or propanaldehyde.; mutation to L: Does not significantly reduce the channeling efficiency of the enzyme complex toward acetaldehyde or propanaldehyde.; mutation to W: 5- to 16-fold decrease in catalytic efficiency with aldehydes two to four carbons in length. Exhibits 59% of wild-type acetaldehyde channeling efficiency.
- D208 (= D206) mutation to A: 2-fold decrease in catalytic efficiency.
P9WQH3 Propanal dehydrogenase (CoA-propanoylating); Acetaldehyde dehydrogenase; Acetaldehyde dehydrogenase [acetylating]; EC 1.2.1.87; EC 1.2.1.10 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
55% identity, 98% coverage: 1:313/320 of query aligns to 1:303/303 of P9WQH3
- S41 (= S42) mutation to D: 2200-fold decrease in catalytic efficiency with coenzyme A.; mutation to I: 6600-fold decrease in catalytic efficiency with coenzyme A.
Query Sequence
>H281DRAFT_01665 H281DRAFT_01665 acetaldehyde dehydrogenase
MNEKVKVAIIGPGNIGTDLMIKVMRNSQHLEMAAMVGVDPKSDGLARAERMGVATTAEGI
DGLLKLDVFKNIDIVFDATSASAHKHHNDVLQKHGVQVIDLTPAAVGPYVIPAINLEAEN
ASNMNMVTCGGQATIPIVAAVSRVAKVHYAEIVASISSRSAGPGTRANIDEFTETTRSAI
ETLGGATRGKAIIVLNPAEPPLIMRDTVFVLSDLVDVNAVEDSVAQMITSVQAYVPGYRL
KQKIQFDIVSPEKPLNVPGLGVKHGLKTSVFLEVEGAAHYLPSYAGNLDIMTSAALACGD
MMARRRLAAGVVRGQKEPIQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory