SitesBLAST
Comparing H281DRAFT_01693 FitnessBrowser__Burk376:H281DRAFT_01693 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jlwA Crystal structure of formaldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
43% identity, 96% coverage: 2:367/381 of query aligns to 3:380/395 of 4jlwA
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), D168 (= D161), T172 (= T165), G194 (= G187), P195 (= P188), V196 (= V189), D216 (= D209), R221 (= R214), V261 (= V253), R266 (vs. gap), H268 (vs. gap), V281 (≠ T269), P298 (≠ V286), L300 (≠ V288), Q336 (= Q324), T337 (≠ C325)
- binding zinc ion: C45 (= C38), H66 (= H59), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), D168 (= D161)
P46154 Glutathione-independent formaldehyde dehydrogenase; FALDH; FDH; Formaldehyde dismutase; EC 1.2.1.46; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
41% identity, 96% coverage: 2:367/381 of query aligns to 5:382/399 of P46154
- C47 (= C38) binding
- GSDQH 48:52 (≠ GSDLH 39:43) binding
- H68 (= H59) binding
- C98 (= C89) binding
- C101 (= C92) binding
- C104 (= C95) binding
- C112 (= C103) binding
- V198 (= V189) binding
- D218 (= D209) binding
- R223 (= R214) binding
- V263 (= V253) binding
- RGH 268:270 (vs. gap) binding
- PGL 300:302 (≠ VGV 286:288) binding
- GQT 337:339 (≠ GQC 323:325) binding
1kolA Crystal structure of formaldehyde dehydrogenase (see paper)
41% identity, 96% coverage: 2:367/381 of query aligns to 3:380/396 of 1kolA
- active site: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), H66 (= H59), E67 (= E60), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), N114 (= N107), D168 (= D161), T172 (= T165)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), F92 (= F85), D168 (= D161), T172 (= T165), G192 (= G185), G194 (= G187), P195 (= P188), V196 (= V189), D216 (= D209), L217 (≠ R210), R221 (= R214), A260 (≠ C252), V261 (= V253), R266 (vs. gap), H268 (vs. gap), V281 (≠ T269), P298 (≠ V286), L300 (≠ V288), Q336 (= Q324), T337 (≠ C325)
- binding zinc ion: C45 (= C38), H66 (= H59), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), D168 (= D161)
Sites not aligning to the query:
2dphA Crystal structure of formaldehyde dismutase
39% identity, 100% coverage: 2:381/381 of query aligns to 4:393/398 of 2dphA
- active site: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), H66 (= H59), E67 (= E60), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), L114 (≠ N107), S168 (≠ A160), D169 (= D161), P172 (= P164), K386 (= K374)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), G46 (= G39), S47 (= S40), H50 (= H43), F92 (= F85), D169 (= D161), T173 (= T165), A192 (≠ Y184), G193 (= G185), G195 (= G187), P196 (= P188), V197 (= V189), G216 (≠ V208), D217 (= D209), Q218 (≠ R210), R222 (= R214), L236 (≠ D228), V262 (= V253), H267 (= H258), P298 (≠ V286), G299 (= G287), I300 (≠ V288), A337 (≠ C325)
- binding zinc ion: C45 (= C38), H66 (= H59), C96 (= C89), C99 (= C92), C102 (= C95), C110 (= C103), D169 (= D161)
Q52078 Formaldehyde dismutase; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
39% identity, 100% coverage: 2:381/381 of query aligns to 5:394/399 of Q52078
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:399 modified: mature protein, Formaldehyde dismutase
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
34% identity, 99% coverage: 1:378/381 of query aligns to 1:346/346 of 4cpdA
- active site: C38 (= C38), G39 (= G39), S40 (= S40), H43 (= H43), H59 (= H59), E60 (= E60), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), G107 (≠ A115), D152 (= D161), T156 (= T165), K340 (≠ W372)
- binding nicotinamide-adenine-dinucleotide: G39 (= G39), S40 (= S40), T156 (= T165), G178 (= G187), P179 (= P188), V180 (= V189), D200 (= D209), R201 (= R210), R205 (= R214), A243 (≠ C252), V244 (= V253), V266 (= V286), V268 (= V288), L292 (≠ Q324), A293 (≠ C325), F333 (= F365)
- binding zinc ion: C38 (= C38), H59 (= H59), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), D152 (= D161)
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
33% identity, 99% coverage: 1:378/381 of query aligns to 5:342/348 of 5ylnA
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
36% identity, 65% coverage: 11:256/381 of query aligns to 13:250/357 of 7y9pA
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
31% identity, 84% coverage: 1:320/381 of query aligns to 2:281/339 of 5kiaA
- active site: C37 (= C38), G38 (= G39), T39 (≠ S40), H42 (= H43), H61 (= H59), E62 (= E60), C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103), V109 (≠ A113), P147 (≠ I162), A151 (≠ G166)
- binding calcium ion: D146 (= D161), N150 (≠ T165)
- binding zinc ion: C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103)
Sites not aligning to the query:
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
30% identity, 99% coverage: 1:378/381 of query aligns to 1:339/341 of P07913
- C38 (= C38) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
4eezB Crystal structure of lactococcus lactis alcohol dehydrogenase variant re1 (see paper)
32% identity, 74% coverage: 1:281/381 of query aligns to 1:280/342 of 4eezB
- active site: C39 (= C38), H40 (≠ G39), T41 (≠ S40), H44 (= H43), H60 (= H59), E61 (= E60), C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103), K109 (≠ G111), C147 (≠ V159), T151 (= T165)
- binding zinc ion: C39 (= C38), H60 (= H59), E61 (= E60), C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103), C147 (≠ V159)
Sites not aligning to the query:
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
27% identity, 97% coverage: 8:378/381 of query aligns to 12:344/347 of 5vm2A
- active site: C39 (= C38), G40 (= G39), S41 (= S40), H44 (= H43), H65 (= H59), E66 (= E60), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), D113 (vs. gap), P153 (≠ V159), G157 (= G166), K340 (= K374)
- binding magnesium ion: H65 (= H59), E66 (= E60), E152 (≠ M158)
- binding zinc ion: C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103)
1h2bB Crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution (see paper)
31% identity, 65% coverage: 12:257/381 of query aligns to 13:251/344 of 1h2bB
- active site: C39 (= C38), H40 (≠ G39), T41 (≠ S40), H44 (= H43), H64 (= H59), E65 (= E60), D94 (≠ C89), C97 (= C92), C100 (= C95), C108 (= C103), E112 (= E109), D153 (= D161), T157 (= T165)
- binding nicotinamide-adenine-dinucleotide (acidic form): C39 (= C38), H40 (≠ G39), T41 (≠ S40), H44 (= H43), T157 (= T165), V180 (≠ S186), G181 (= G187), G182 (≠ P188), L183 (≠ V189), D203 (= D209), V204 (≠ R210), K208 (≠ R214), F246 (≠ C252), V247 (= V253)
- binding octanoic acid (caprylic acid): T41 (≠ S40), W50 (vs. gap), H64 (= H59), D153 (= D161)
- binding zinc ion: C39 (= C38), H64 (= H59), D94 (≠ C89), C97 (= C92), C100 (= C95), C108 (= C103), D153 (= D161)
Sites not aligning to the query:
7xy9A Cryo-em structure of secondary alcohol dehydrogenases tbsadh after carrier-free immobilization based on weak intermolecular interactions
29% identity, 93% coverage: 25:379/381 of query aligns to 25:334/344 of 7xy9A
- binding magnesium ion: H101 (≠ N107), H103 (≠ E109), H158 (= H168), C288 (= C325), G290 (≠ N326), G291 (≠ V327), L293 (≠ A329), R294 (≠ Y330)
- binding zinc ion: C38 (= C38), H60 (= H59), E61 (= E60), D151 (= D161)
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
31% identity, 65% coverage: 16:263/381 of query aligns to 21:260/346 of 2dfvA
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (= H43), H65 (= H59), E66 (= E60), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), K113 (≠ N107), P151 (≠ D155), A155 (≠ V159)
- binding nicotinamide-adenine-dinucleotide: G175 (= G187), P176 (= P188), L177 (≠ V189), E197 (≠ D209), P198 (≠ R210), R202 (= R214), F241 (≠ C252), S242 (≠ V253), A244 (vs. gap)
- binding zinc ion: C95 (= C89), C101 (= C95), C109 (= C103)
Sites not aligning to the query:
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
31% identity, 65% coverage: 16:263/381 of query aligns to 23:262/348 of O58389
- C42 (= C38) binding
- T44 (≠ S40) mutation to A: Total loss of enzymatic activity.
- H67 (= H59) binding
- E68 (= E60) binding
- C97 (= C89) binding
- C100 (= C92) binding
- C103 (= C95) binding
- C111 (= C103) binding
- E152 (≠ N154) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ V189) binding
- E199 (≠ D209) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R214) binding ; mutation to A: Large decrease in affinity for NAD(+).
Sites not aligning to the query:
- 266:268 binding
- 291:292 binding
- 294 R→A: 4000-fold decrease in catalytic efficiency.
3fplA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of c. Beijerinckii adh by t. Brockii adh (see paper)
30% identity, 86% coverage: 23:351/381 of query aligns to 18:322/351 of 3fplA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H59), E60 (= E60), D89 (≠ C89), S92 (≠ C92), V95 (≠ C95), S103 (≠ P108), D150 (= D161), T154 (= T165)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D161)
Sites not aligning to the query:
7ux4A Crystallographic snapshots of ternary complexes of thermophilic secondary alcohol dehydrogenase from thermoanaerobacter pseudoethanolicus reveal the dynamics of ligand exchange and the proton relay network. (see paper)
28% identity, 93% coverage: 25:379/381 of query aligns to 22:339/350 of 7ux4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D148 (= D161), T152 (= T165), G172 (= G185), I173 (≠ S186), G174 (= G187), P175 (= P188), V176 (= V189), R198 (≠ H211), G242 (= G254), V263 (= V286), N264 (≠ G287), Y265 (≠ V288), C293 (= C325)
- binding (1S,3S)-3-methylcyclohexan-1-ol: S37 (= S40), H57 (= H59), W108 (≠ F117), D148 (= D161)
- binding zinc ion: C35 (= C38), H57 (= H59), E58 (= E60), D148 (= D161)
7uutA Ternary complex crystal structure of secondary alcohol dehydrogenases from the thermoanaerobacter ethanolicus mutants c295a and i86a provides better understanding of catalytic mechanism (see paper)
28% identity, 93% coverage: 25:379/381 of query aligns to 24:341/352 of 7uutA
- binding (2R)-pentan-2-ol: S39 (= S40), H59 (= H59), A85 (≠ F85), W110 (≠ F117), D150 (= D161), C295 (= C325)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C37 (= C38), T38 (≠ G39), S39 (= S40), D150 (= D161), T154 (= T165), G174 (= G185), G176 (= G187), P177 (= P188), V178 (= V189), S199 (≠ R210), R200 (≠ H211), A242 (≠ C252), G243 (≠ V253), G244 (= G254), I248 (≠ T269), V265 (= V286), N266 (≠ G287), Y267 (≠ V288), C295 (= C325), K340 (= K378)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D161)
1ykfA NADP-dependent alcohol dehydrogenase from thermoanaerobium brockii (see paper)
28% identity, 93% coverage: 25:379/381 of query aligns to 24:341/352 of 1ykfA
- active site: C37 (= C38), T38 (≠ G39), S39 (= S40), H42 (= H43), H59 (= H59), E60 (= E60), D89 (≠ C89), T92 (≠ C92), V95 (≠ C95), S103 (≠ P110), D150 (= D161), T154 (= T165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (= S40), D150 (= D161), T154 (= T165), G174 (= G185), I175 (≠ S186), G176 (= G187), P177 (= P188), V178 (= V189), S199 (≠ R210), R200 (≠ H211), Y218 (≠ S229), I223 (≠ V234), N266 (≠ G287), Y267 (≠ V288)
- binding zinc ion: C37 (= C38), H59 (= H59), D150 (= D161)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_01693 FitnessBrowser__Burk376:H281DRAFT_01693
MKAVVYRGPRDVSVENVPDPKIERPTDVIVQIRSTNICGSDLHMFEGRTDFEKGRVFGHE
NLGQVTEVGQAVERLKVGDWVCMPFNISCGHCRNCEKGLTAFCLAANPEPGMAGAAFGFA
DMGPYQGGQAEYLRVPWADFNCLKLPPDAEEKQNDYVMVADIFPTGWHCTELAGMRPGDA
VVIYGSGPVGLMAAHAAMVKGACNVMVVDRHPDRLRLAESIGAVAIDDSKCNPVERIKEL
THGLGADVGCECVGYQCHDPAGKEVPNLTMNNLVQSVKFTGGIGVVGVFTPQDPGAPDDL
AKKGQIAFDWGMCWFKGQHIATGQCNVKAYNRQLRDLIHAGRAKPSFIVSHELELSRAAE
AYQHFDSRDHGWTKVVLKPAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory