SitesBLAST
Comparing H281DRAFT_01718 FitnessBrowser__Burk376:H281DRAFT_01718 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
32% identity, 89% coverage: 10:410/452 of query aligns to 13:420/425 of O59010
- S65 (= S60) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A271) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ AST 271:273) binding
- M311 (≠ A306) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T309) binding
- V355 (= V350) binding
- D394 (≠ N384) binding
- M395 (≠ E385) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R387) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N391) binding
- D405 (≠ N395) mutation to N: Strongly decreased affinity for aspartate.
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
32% identity, 88% coverage: 10:409/452 of query aligns to 13:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L41), F46 (≠ L41), P75 (≠ D70), L91 (≠ V87), F95 (≠ I91), L130 (≠ R129), I133 (≠ G132), I159 (≠ L162), Y167 (vs. gap), K196 (≠ G191), G200 (≠ I195), I207 (= I202), F210 (= F205), L250 (≠ V245), I262 (≠ L257), M269 (≠ I264), T334 (= T329), V335 (≠ I330), G336 (≠ W331), T340 (≠ L335), L343 (≠ G338), M399 (≠ V389)
- binding aspartic acid: S277 (= S272), S278 (≠ T273), T314 (= T309), G354 (= G349), A358 (= A353), G359 (= G354), D394 (≠ N384), R397 (= R387), T398 (≠ A388)
- binding sodium ion: Y89 (≠ F85), T92 (≠ A88), S93 (= S89), G306 (= G301), T308 (= T303), N310 (= N305), N310 (= N305), M311 (≠ A306), D312 (= D307), S349 (= S344), I350 (≠ K345), T352 (≠ S347), N401 (= N391), V402 (≠ L392), D405 (≠ N395)
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
32% identity, 88% coverage: 10:406/452 of query aligns to 4:407/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
32% identity, 88% coverage: 10:406/452 of query aligns to 10:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G64), V83 (≠ L82), I157 (≠ L163), Y164 (vs. gap), K193 (≠ G191), T305 (= T303), I306 (≠ F304), I347 (≠ K345)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L13), M199 (= M197), S275 (≠ T273), T311 (= T309), G356 (= G354), L384 (= L377), D391 (≠ N384), R394 (= R387)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
32% identity, 88% coverage: 10:407/452 of query aligns to 5:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
32% identity, 88% coverage: 10:406/452 of query aligns to 5:408/408 of 6bauA
- binding cysteine: S270 (≠ T273), M303 (≠ A306), T306 (= T309), A345 (= A348), G346 (= G349), V347 (= V350), G351 (= G354), D386 (≠ N384), C389 (≠ R387), T390 (≠ A388), N393 (= N391)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
33% identity, 89% coverage: 10:410/452 of query aligns to 9:418/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
33% identity, 89% coverage: 10:410/452 of query aligns to 8:417/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ G191), G195 (≠ I195), R282 (≠ L281)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A271), S272 (= S272), S273 (≠ T273), M307 (≠ A306), T310 (= T309), G353 (= G352), A354 (= A353), R394 (= R387), T395 (≠ A388)
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
33% identity, 89% coverage: 10:410/452 of query aligns to 11:420/427 of 5e9sA
- binding aspartic acid: R274 (≠ A271), S275 (= S272), S276 (≠ T273), T313 (= T309), G353 (= G349), V354 (= V350), A357 (= A353), G358 (= G354), D394 (≠ N384), R397 (= R387), T398 (≠ A388)
- binding decyl-beta-d-maltopyranoside: L194 (≠ G191), G198 (≠ I195), Y202 (≠ V199)
- binding sodium ion: Y87 (≠ F85), T90 (≠ A88), S91 (= S89), S276 (≠ T273), G305 (= G301), A306 (≠ Y302), T307 (= T303), N309 (= N305), N309 (= N305), M310 (≠ A306), D311 (= D307), S348 (= S344), I349 (≠ K345), G350 (= G346), T351 (≠ S347), N401 (= N391), V402 (≠ L392), D405 (≠ N395)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
33% identity, 89% coverage: 10:410/452 of query aligns to 11:420/426 of 6xwnB
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
33% identity, 89% coverage: 10:410/452 of query aligns to 4:409/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A271), S265 (≠ T273), M299 (≠ A306), T302 (= T309), T340 (≠ S347), G342 (= G349), V343 (= V350), G347 (= G354), D383 (≠ N384), R386 (= R387), T387 (≠ A388), N390 (= N391)
- binding decyl-beta-d-maltopyranoside: H23 (= H29), V212 (≠ L220), A216 (≠ G224)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
29% identity, 88% coverage: 10:406/452 of query aligns to 5:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
27% identity, 85% coverage: 20:402/452 of query aligns to 33:398/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ A74), G89 (= G75), G92 (= G78), A95 (= A81), V96 (≠ L82), Y99 (≠ F85), M163 (≠ L162), F167 (≠ I166), F293 (≠ M296), V297 (≠ T300)
- binding aspartic acid: S268 (= S272), S269 (≠ T273), T306 (= T309), G346 (= G349), I347 (≠ V350), A350 (= A353), G351 (= G354), D380 (≠ N384), R383 (= R387), T384 (≠ A388)
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
26% identity, 93% coverage: 1:422/452 of query aligns to 11:477/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (= N151) modified: carbohydrate, N-linked (GlcNAc...) asparagine
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
25% identity, 85% coverage: 20:402/452 of query aligns to 25:384/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I65), S80 (≠ A74), G81 (= G75), G84 (= G78), Y91 (≠ F85), M156 (≠ L162), F160 (≠ I166), F286 (≠ M296), V290 (≠ T300)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I57), I148 (≠ M154), S262 (≠ T273), S263 (≠ E274), A292 (≠ Y302), T293 (= T303), M296 (≠ A306), T299 (= T309), G329 (= G346), A336 (= A353), G337 (= G354), D366 (≠ N384), R369 (= R387), N373 (= N391)
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
25% identity, 80% coverage: 42:404/452 of query aligns to 43:403/416 of 8cuaA
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
25% identity, 80% coverage: 42:404/452 of query aligns to 40:400/406 of 8ctcA
- binding glutamic acid: S268 (= S272), S269 (≠ T273), M303 (≠ A306), T306 (= T309), G346 (= G349), A350 (= A353), D380 (≠ N384), R383 (= R387)
- binding sodium ion: Y82 (≠ F85), T85 (≠ A88), T86 (≠ S89), S269 (≠ T273), G298 (= G301), A299 (≠ Y302), T300 (= T303), N302 (= N305), N302 (= N305), M303 (≠ A306), D304 (= D307), S341 (= S344), I342 (≠ K345), G343 (= G346), A344 (≠ S347), N387 (= N391), D391 (≠ N395)
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
26% identity, 87% coverage: 42:436/452 of query aligns to 79:516/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
26% identity, 80% coverage: 42:404/452 of query aligns to 43:421/433 of 8cv2A
- binding sodium ion: Y85 (≠ F85), T88 (≠ A88), T89 (≠ S89), G319 (= G301), A320 (≠ Y302), N323 (= N305), N323 (= N305), M324 (≠ A306), D325 (= D307), N408 (= N391), D412 (≠ N395)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
26% identity, 87% coverage: 17:410/452 of query aligns to 19:419/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S272), S281 (≠ T273), T318 (= T309), G363 (= G354), M367 (≠ L358), V385 (≠ L377), D388 (= D380), R395 (= R387), T396 (≠ A388)
- binding dodecyl beta-D-glucopyranoside: V19 (= V17), I20 (≠ L18), W389 (≠ R381)
- binding cholesterol hemisuccinate: R80 (= R76), R84 (≠ K80), I95 (= I91), I252 (≠ V241)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_01718 FitnessBrowser__Burk376:H281DRAFT_01718
MLVSKVRKTLSKLYLQVLIGIIAGILLGHFYPDVGSQLKPLGDLFIKLIRMLLAPIIFAS
VVVGIARMNDLHEAGRVGVKALLYFEVASTIALLVGMVVVNVFKPGAGMNVDPSHIDGSA
ISTYTTAARQHGMLDFFTSIVPNSIVGAFANGEMLPIIFFSLLLAISLARLGPRTAPFVD
MLDMFLQGMFGVVRIVMYVAPIGAFGGMAFTIAKYGIGTLASFGQLMLCLYLTSIFFVVV
VLGLVMRMCGLSLFKYLRYIKDEILITLGTASTEAVLPQMLVKMERMGCSRPVVGMVLPT
GYTFNADGTAIYLTMAALFIAQAMNVHLTIWDQLLVLGVLLLTSKGSAGVAGAGFVALAA
TLASMHKIPVEGLVLLLGVDRFLNEARAVTNLIGNGVATVVVARWEGQLDMNTARAVLNR
TYVAEFEELQPIDNPAIASASTGDASVRSNAH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory