SitesBLAST
Comparing H281DRAFT_01746 FitnessBrowser__Burk376:H281DRAFT_01746 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 88% coverage: 23:318/335 of query aligns to 67:378/466 of P87228
- S87 (≠ T43) modified: Phosphoserine
- S258 (≠ T210) modified: Phosphoserine
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
32% identity, 85% coverage: 36:319/335 of query aligns to 32:318/533 of O43175
- T78 (≠ V82) binding
- R135 (≠ A139) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ QI 158:159) binding
- D175 (= D178) binding
- T207 (≠ A207) binding
- CAR 234:236 (≠ AAR 234:236) binding
- D260 (= D260) binding
- V261 (= V261) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIGG 284:287) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
34% identity, 83% coverage: 33:310/335 of query aligns to 29:304/304 of 1wwkA
- active site: S96 (≠ F106), R230 (= R236), D254 (= D260), E259 (≠ M268), H278 (= H284)
- binding nicotinamide-adenine-dinucleotide: V100 (= V110), G146 (= G155), F147 (≠ Y156), G148 (= G157), R149 (≠ Q158), I150 (= I159), Y168 (≠ S177), D169 (= D178), P170 (= P179), V201 (≠ A207), P202 (= P208), T207 (= T213), T228 (≠ A234), S229 (≠ A235), D254 (= D260), H278 (= H284), G280 (= G286)
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
31% identity, 82% coverage: 36:310/335 of query aligns to 28:305/305 of 6plfA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
32% identity, 80% coverage: 36:303/335 of query aligns to 27:297/301 of 6rj5A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
32% identity, 80% coverage: 36:303/335 of query aligns to 26:296/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ F106), A100 (≠ V110), R149 (≠ Q158), I150 (= I159), Y168 (≠ S177), D169 (= D178), P170 (= P179), I171 (≠ Y180), H200 (≠ L206), T201 (≠ A207), P202 (= P208), T207 (= T213), C228 (≠ A234), A229 (= A235), R230 (= R236), H277 (= H284), G279 (= G286)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
32% identity, 80% coverage: 36:303/335 of query aligns to 27:297/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ I154), G147 (= G155), L148 (≠ Y156), G149 (= G157), R150 (≠ Q158), I151 (= I159), G152 (≠ S160), D170 (= D178), H201 (≠ L206), T202 (≠ A207), P203 (= P208)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
32% identity, 80% coverage: 36:303/335 of query aligns to 26:296/297 of 6rj3A
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
32% identity, 80% coverage: 36:303/335 of query aligns to 27:297/302 of 6rihA
7dkmA Phgdh covalently linked to oridonin (see paper)
32% identity, 80% coverage: 36:303/335 of query aligns to 28:298/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V82), A102 (≠ V110), G148 (= G155), R151 (≠ Q158), I152 (= I159), Y170 (≠ S177), D171 (= D178), P172 (= P179), I173 (≠ Y180), H202 (≠ L206), T203 (≠ A207), P204 (= P208), T209 (= T213), C230 (≠ A234), A231 (= A235), R232 (= R236), H279 (= H284), G281 (= G286)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ M298)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
32% identity, 80% coverage: 36:303/335 of query aligns to 27:297/303 of 6plgA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
32% identity, 80% coverage: 36:303/335 of query aligns to 24:294/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G157), I148 (= I159), Y166 (≠ S177), D167 (= D178), P168 (= P179), I169 (≠ Y180), I170 (≠ A181), H198 (≠ L206), T199 (≠ A207), L208 (= L216), R228 (= R236)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
33% identity, 93% coverage: 7:318/335 of query aligns to 1:312/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
32% identity, 93% coverage: 9:318/335 of query aligns to 2:311/526 of 3dc2A
Sites not aligning to the query:
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
37% identity, 78% coverage: 44:303/335 of query aligns to 42:307/406 of 2p9eA
- active site: N104 (≠ F106), R236 (= R236), D260 (= D260), E265 (vs. gap), H288 (= H284)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G157), H157 (≠ Q158), I158 (= I159), Y176 (≠ S177), D177 (= D178), I178 (≠ P179), H206 (≠ L206), V207 (≠ A207), P208 (= P208), S212 (≠ Q212), A234 (= A234), S235 (≠ A235), R236 (= R236), H288 (= H284), G290 (= G286)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
28% identity, 93% coverage: 1:312/335 of query aligns to 1:322/334 of 3kb6B
- active site: S97 (≠ F106), R231 (= R236), D255 (= D260), E260 (vs. gap), H294 (= H284)
- binding lactic acid: F49 (≠ Y58), S72 (≠ A81), V73 (= V82), G74 (≠ D83), Y96 (≠ G105), R231 (= R236), H294 (= H284)
- binding nicotinamide-adenine-dinucleotide: V73 (= V82), Y96 (≠ G105), V101 (= V110), G150 (= G157), R151 (≠ Q158), I152 (= I159), D171 (≠ A181), V172 (≠ T182), P203 (= P208), T229 (≠ A234), A230 (= A235), R231 (= R236), H294 (= H284), A296 (≠ G286), Y297 (≠ G287)
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 78% coverage: 44:303/335 of query aligns to 46:311/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
36% identity, 78% coverage: 44:303/335 of query aligns to 42:307/406 of 1ybaA
- active site: N104 (≠ F106), R236 (= R236), D260 (= D260), E265 (vs. gap), H288 (= H284)
- binding 2-oxoglutaric acid: R56 (≠ Y58), S57 (≠ R59), C79 (≠ A81), I80 (≠ V82)
- binding nicotinamide-adenine-dinucleotide: I80 (≠ V82), F102 (≠ A104), V108 (= V110), G154 (= G155), G156 (= G157), H157 (≠ Q158), I158 (= I159), Y176 (≠ S177), D177 (= D178), I178 (≠ P179), K181 (≠ T182), H206 (≠ L206), V207 (≠ A207), P208 (= P208), A234 (= A234), S235 (≠ A235), R236 (= R236), H288 (= H284), G290 (= G286)
- binding phosphate ion: G81 (≠ D83), N83 (≠ R85)
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
36% identity, 78% coverage: 44:303/335 of query aligns to 40:305/404 of 1psdA
- active site: N102 (≠ F106), R234 (= R236), D258 (= D260), E263 (vs. gap), H286 (= H284)
- binding nicotinamide-adenine-dinucleotide: N102 (≠ F106), H155 (≠ Q158), I156 (= I159), D175 (= D178), I176 (≠ P179), K179 (≠ T182), H204 (≠ L206), V205 (≠ A207), P206 (= P208), A232 (= A234), S233 (≠ A235), R234 (= R236), H286 (= H284)
Sites not aligning to the query:
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 71% coverage: 67:303/335 of query aligns to 49:288/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ Q158), Y160 (≠ S177), D161 (= D178), P162 (= P179), I164 (≠ A181), L179 (= L193), T193 (≠ A207), P194 (= P208), S198 (≠ Q212), L202 (= L216)
Query Sequence
>H281DRAFT_01746 FitnessBrowser__Burk376:H281DRAFT_01746
MNKVFVSHPRHMLDHYFGTRAAAALAKFADVTYNSEDRELTLTELADAAREADVIIAYRQ
TPAPRALFEALPKLAAFVRCAVDIRTVDVDAASELGVLVTQASAGFIPAVSEWVIGAMLD
LARGTTAYAEAYHRHEAPAPKMGRELRGSTFGVIGYGQISRYLCPLASAFGMRVIVSDPY
ATIDDTHVQQVGLDDLLAESDFVVCLAPATPQTANLMNAQTFASMKAGAYFINAARGELV
DDAALLAALERGHLAGCALDVGRAADQMPSPELAAHPRVIATPHIGGLTPGAIEHQSMET
VAQTQALFQGRMPAGAVNAAHAYRLSGFAMPTDAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory