SitesBLAST
Comparing H281DRAFT_01762 FitnessBrowser__Burk376:H281DRAFT_01762 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
45% identity, 89% coverage: 48:446/450 of query aligns to 39:435/478 of Q47945
Sites not aligning to the query:
- 1:36 signal peptide
- 37 modified: Pyrrolidone carboxylic acid
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
45% identity, 89% coverage: 48:446/450 of query aligns to 1:397/433 of 8gy2B
- binding heme c: C18 (= C65), C21 (= C68), H22 (= H69), T46 (= T94), I48 (= I96), Y59 (= Y107), L68 (= L116), R73 (≠ A121), V79 (≠ L127), Y80 (= Y128), M83 (= M131), F88 (= F136), R126 (= R174), H165 (= H212), C166 (= C213), C169 (= C216), H170 (= H217), I201 (≠ F246), A202 (= A247), P203 (= P248), L205 (= L250), W216 (≠ L261), F224 (= F269), A234 (≠ V281), V235 (≠ T282), F236 (= F283), F236 (= F283), M239 (= M286), N301 (≠ F351), C302 (= C352), C305 (= C355), H306 (= H356), M316 (≠ K366), F317 (= F367), P318 (= P368), L320 (= L370), P324 (= P374), G342 (= G392), S352 (≠ I402), V354 (≠ R404), M356 (= M406), F359 (= F409), M375 (≠ V425)
- binding ubiquinone-10: C21 (= C68), L34 (= L82), P39 (= P87), P81 (= P129), L129 (= L177), W132 (= W180), E168 (≠ A215), R173 (= R220), I197 (vs. gap), D241 (≠ E288)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
40% identity, 88% coverage: 53:450/450 of query aligns to 1:391/418 of 7w2jC
- binding heme c: C13 (= C65), C16 (= C68), H17 (= H69), T42 (= T94), I44 (= I96), Y55 (= Y107), L75 (= L127), Y76 (= Y128), A78 (= A130), M79 (= M131), R122 (= R174), H161 (= H212), C162 (= C213), C165 (= C216), H166 (= H217), A191 (= A247), P192 (= P248), R223 (≠ V281), P227 (≠ S285), M228 (= M286), V289 (≠ F351), C290 (= C352), C293 (= C355), H294 (= H356), Y305 (≠ K366), Y306 (≠ F367), P307 (= P368), L309 (= L370), N312 (= N373), T313 (≠ P374), T314 (≠ A375), D322 (≠ S383), I327 (≠ V388), V331 (≠ T393), R333 (≠ P395), I340 (= I402), M342 (= M406), P343 (= P407), F345 (= F409)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
39% identity, 88% coverage: 53:450/450 of query aligns to 1:405/413 of 8jejC
- binding heme c: C13 (= C65), C16 (= C68), H17 (= H69), T42 (= T94), I44 (= I96), F60 (= F112), L64 (= L116), L75 (= L127), Y76 (= Y128), M79 (= M131), P80 (= P132), Y84 (≠ F136), R122 (= R174), C162 (= C213), C165 (= C216), H166 (= H217), I186 (≠ N242), W189 (= W245), A191 (= A247), P192 (= P248), I194 (≠ L250), W205 (≠ L261), Y213 (≠ F269), R223 (≠ V281), M228 (= M286), V303 (≠ F351), C304 (= C352), C307 (= C355), H308 (= H356), Y320 (≠ F367), P321 (= P368), L323 (= L370), T327 (≠ P374), T328 (≠ A375), D336 (≠ S383), I341 (≠ V388), V345 (≠ T393), R347 (≠ P395), I354 (= I402), M356 (= M406), F359 (= F409), I376 (≠ V421)
- binding ubiquinone-10: M36 (≠ F88), P77 (= P129), S124 (≠ G176), W128 (= W180), C165 (= C216), L173 (≠ F224)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
36% identity, 83% coverage: 53:426/450 of query aligns to 41:408/440 of 8gy3A
- binding heme c: Y52 (≠ D64), C53 (= C65), C56 (= C68), H57 (= H69), S84 (≠ T94), I86 (= I96), W97 (≠ Y107), F102 (= F112), L117 (= L127), F121 (≠ M131), F126 (= F136), R163 (= R174), C203 (= C213), C206 (= C216), H207 (= H217), A232 (= A247), P233 (= P248), L235 (= L250), W245 (≠ L261), Y253 (≠ F269), L254 (= L270), G263 (≠ V280), S264 (≠ V281), M269 (= M286), Y292 (≠ L309), C337 (= C352), C340 (= C355), H341 (= H356), P353 (= P368), L355 (= L370), N358 (= N373), N359 (≠ P374), V372 (≠ L387), I377 (≠ G392), G382 (= G400), Q383 (≠ P401), I386 (≠ R404), M388 (= M406), F391 (= F409)
- binding ubiquinone-10: E55 (≠ G67), T76 (≠ S86), F78 (= F88), Y118 (= Y128), P119 (= P129), I160 (≠ F171), G166 (= G176), Q167 (≠ L177), F169 (= F179), W170 (= W180), H202 (= H212), R210 (= R220), L213 (≠ R227)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
34% identity, 28% coverage: 322:445/450 of query aligns to 2:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C352), C33 (= C355), H34 (= H356), Y46 (vs. gap), P47 (= P368), T54 (≠ A375), V66 (≠ L387), I67 (≠ V388), R73 (≠ T397), I80 (≠ R404), M82 (= M406), P83 (= P407)
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
29% identity, 34% coverage: 297:447/450 of query aligns to 310:454/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ F351), C360 (= C352), C363 (= C355), H364 (= H356), P376 (= P368), P377 (≠ A369), L378 (= L370), F383 (≠ V376), N400 (≠ T393), G401 (≠ S394), Y410 (≠ H403), S412 (≠ E405), M414 (≠ P407), M417 (≠ R410)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
29% identity, 34% coverage: 297:447/450 of query aligns to 313:457/457 of 4ax3D
- binding heme c: C363 (= C352), C366 (= C355), H367 (= H356), P379 (= P368), P380 (≠ A369), L381 (= L370), S384 (≠ N373), F386 (≠ V376), N403 (≠ T393), G404 (≠ S394), S415 (≠ E405), M417 (≠ P407), M420 (≠ R410)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
29% identity, 34% coverage: 297:447/450 of query aligns to 311:455/456 of 5oboA
- binding heme c: T360 (≠ F351), C361 (= C352), C364 (= C355), H365 (= H356), P377 (= P368), P378 (≠ A369), L379 (= L370), S382 (≠ N373), F384 (≠ V376), I395 (≠ L387), N401 (≠ T393), G402 (≠ S394), S413 (≠ E405), M415 (≠ P407), M418 (≠ R410)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
1dt1A Thermus thermophilus cytochrome c552 synthesized by escherichia coli (see paper)
37% identity, 23% coverage: 344:447/450 of query aligns to 2:112/129 of 1dt1A
- binding heme c: C9 (= C352), C12 (= C355), H13 (= H356), P25 (= P368), H30 (≠ N373), Y43 (≠ L384), V47 (= V388), Q53 (≠ S394), G54 (≠ P395), G65 (≠ E405), M67 (≠ P407), F70 (≠ R410)
Sites not aligning to the query:
1c52A Thermus thermophilus cytochrome-c552: a new highly thermostable cytochromE-C structure obtained by mad phasing (see paper)
37% identity, 23% coverage: 344:447/450 of query aligns to 4:114/131 of 1c52A
- binding protoporphyrin ix containing fe: C11 (= C352), C14 (= C355), H15 (= H356), F26 (= F367), P27 (= P368), L29 (= L370), H32 (≠ N373), Y45 (≠ L384), L54 (≠ T393), Q55 (≠ S394), G56 (≠ P395), G67 (≠ E405), M69 (≠ P407), F72 (≠ R410)
Sites not aligning to the query:
1r0qA Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (spirographis) heme (see paper)
37% identity, 23% coverage: 344:447/450 of query aligns to 3:113/130 of 1r0qA
- binding 2-formyl-protoporphryn ix: C13 (= C355), H14 (= H356), P26 (= P368), L28 (= L370), H31 (≠ N373), Y44 (≠ L384), V48 (= V388), Q54 (≠ S394), G55 (≠ P395), G66 (≠ E405), M68 (≠ P407)
Sites not aligning to the query:
1qyzA Characterization of the malformed, recombinant cytochrome rc552 (see paper)
37% identity, 23% coverage: 344:447/450 of query aligns to 3:113/130 of 1qyzA
- binding 2-acetyl-protoporphyrin ix: Y7 (= Y348), C10 (= C352), C13 (= C355), H14 (= H356), P26 (= P368), H31 (≠ N373), Y44 (≠ L384), Q54 (≠ S394), G55 (≠ P395), G66 (≠ E405), M68 (≠ P407), F71 (≠ R410)
Sites not aligning to the query:
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
31% identity, 27% coverage: 326:445/450 of query aligns to 318:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C352), C350 (= C355), H351 (= H356), F362 (= F367), P363 (= P368), P364 (≠ A369), L365 (= L370), S368 (≠ N373), Y370 (≠ V376), I382 (≠ V388), L386 (≠ G392), S387 (≠ T393), G388 (≠ S394), I390 (vs. gap), V392 (≠ T397), Y397 (≠ I402), N398 (≠ H403), G399 (≠ R404), V400 (≠ E405), M401 (= M406)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
Query Sequence
>H281DRAFT_01762 FitnessBrowser__Burk376:H281DRAFT_01762
MTDMKRIGPRAAFTAFALTLAMTMVAALCAHSLAQSDSPSVDDEVSLSDPALISRGAYLA
KLGDCAGCHTVPKQGAPFAGGLPMGSPFGTIYSTNITPDPQTGIGRYSYADFERALRDGV
APGGKRLYPAMPYASFTKINDSDMHALYAYFMHGVQPVAHRPPETKLPFPFSQRWGLAFW
DFAFVQHERFIPDGKRDALWNRGAYIVQSLGHCGACHTPRGPGFEERGYDESSKLYLTGG
TNDHWFAPNLTGDPGSGLGRLSPRDIASFLKSGHGVDVHVVTFGSMVEVVEDSGQYFSDD
DLNAVARYLKSLPARQSSGAYKPNTQKLQETAVSLKAGEVERPGAGLYMSFCAKCHQADG
RGEPHKFPALAGNPAVLAPDTSSLIRLVLEGGTSPQTENGPIHREMPAFRNQFTDREIAR
VLSFVRTAWGNEARPVATRDVSTVRSKIKK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory