SitesBLAST
Comparing H281DRAFT_01789 FitnessBrowser__Burk376:H281DRAFT_01789 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
36% identity, 41% coverage: 237:474/586 of query aligns to 151:390/396 of 1gvhA
- binding flavin-adenine dinucleotide: Y188 (= Y273), R204 (= R289), Q205 (≠ S290), Y206 (= Y291), S207 (= S292), A220 (≠ S305), V221 (= V306), E224 (= E309), G227 (= G312), Q228 (≠ L313), V229 (≠ A314), S230 (≠ G315), V269 (≠ I353), T272 (= T356), E388 (= E472), F390 (= F474)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 48, 50
- binding protoporphyrin ix containing fe: 43, 53, 56, 57, 60, 61, 81, 84, 85, 90, 94, 95, 127, 131, 393
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 41% coverage: 237:474/586 of query aligns to 151:390/396 of P24232
Sites not aligning to the query:
- 29 mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; Y→F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- 95 active site, Charge relay system
- 135 active site, Charge relay system
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
36% identity, 42% coverage: 231:474/586 of query aligns to 143:396/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R289), Q207 (≠ S290), Y208 (= Y291), S209 (= S292), S222 (= S305), V223 (= V306), K224 (= K307), E226 (= E309), P232 (= P310), G234 (= G312), Y235 (≠ L313), V236 (≠ A314), S237 (≠ G315), V276 (≠ I353), T279 (= T356), V395 (≠ T473), F396 (= F474)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102, 398
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
36% identity, 42% coverage: 231:474/586 of query aligns to 143:396/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R289), Q207 (≠ S290), Y208 (= Y291), S209 (= S292), S222 (= S305), V223 (= V306), K224 (= K307), E226 (= E309), P232 (= P310), G234 (= G312), Y235 (≠ L313), V236 (≠ A314), S237 (≠ G315), V276 (≠ I353), T279 (= T356), F396 (= F474)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98, 126, 130, 133
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
36% identity, 42% coverage: 231:474/586 of query aligns to 143:396/403 of 3ozuA
- binding flavin-adenine dinucleotide: R206 (= R289), Q207 (≠ S290), Y208 (= Y291), S209 (= S292), S222 (= S305), V223 (= V306), K224 (= K307), E226 (= E309), P232 (= P310), G234 (= G312), Y235 (≠ L313), V236 (≠ A314), S237 (≠ G315), E394 (= E472), V395 (≠ T473)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 397, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: 25, 28, 43, 56, 57, 102, 122, 125, 126
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
36% identity, 42% coverage: 231:474/586 of query aligns to 143:396/403 of P39662
Sites not aligning to the query:
- 60 A→Y: Does not affect phospholipid-binding.
- 98 V→F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
35% identity, 42% coverage: 231:474/586 of query aligns to 143:396/403 of 1cqxA
- binding flavin-adenine dinucleotide: Y190 (= Y273), R206 (= R289), Q207 (≠ S290), Y208 (= Y291), S209 (= S292), S222 (= S305), E226 (= E309), Q231 (vs. gap), P232 (= P310), G234 (= G312), Y235 (≠ L313), V236 (≠ A314), S237 (≠ G315), V395 (≠ T473)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 397, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
36% identity, 40% coverage: 239:474/586 of query aligns to 4:235/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (= Y273), R55 (= R289), Q56 (≠ S290), Y57 (= Y291), S58 (= S292), S71 (= S305), V72 (= V306), E75 (= E309), N81 (≠ P310), G83 (= G312), L84 (= L313), V85 (≠ A314), S86 (≠ G315), T127 (= T356), E233 (= E472), F235 (= F474)
4g1bA X-ray structure of yeast flavohemoglobin in complex with econazole (see paper)
28% identity, 41% coverage: 233:474/586 of query aligns to 144:390/398 of 4g1bA
- binding flavin-adenine dinucleotide: Y189 (= Y273), R207 (= R289), H208 (≠ S290), Y209 (= Y291), S210 (= S292), A223 (≠ S305), K225 (= K307), E227 (= E309), F233 (vs. gap), P234 (= P310), G236 (= G312), L237 (= L313), V238 (≠ A314), S239 (≠ G315), V282 (≠ I353), F390 (= F474)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 28, 29, 56, 57, 60, 102, 126
- binding flavin-adenine dinucleotide: 46, 50, 84
- binding protoporphyrin ix containing fe: 42, 43, 44, 47, 60, 80, 81, 84, 85, 88, 90, 94, 95, 98, 133, 392, 393, 394
6o0aA Crystal structure of flavohemoglobin from malassezia yamatoensis with bound fad and heme determined by iron sad phasing (see paper)
31% identity, 38% coverage: 250:474/586 of query aligns to 166:382/383 of 6o0aA
- binding flavin-adenine dinucleotide: Y190 (= Y273), R205 (= R289), Q206 (≠ S290), F207 (≠ Y291), T208 (≠ S292), K222 (= K307), D224 (≠ E309), H226 (≠ N311), G227 (= G312), E228 (≠ L313), M229 (≠ A314), T230 (≠ G315), T274 (= T356), E380 (= E472), F382 (= F474)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 48, 51, 52, 383
- binding protoporphyrin ix containing fe: 44, 45, 46, 59, 62, 84, 85, 89, 92, 94, 98, 99, 102, 130, 133
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
25% identity, 58% coverage: 239:576/586 of query aligns to 440:741/753 of 6laaA
- binding fe2/s2 (inorganic) cluster: S700 (≠ W537), C702 (= C539), E703 (≠ R540), G705 (= G542), C707 (= C544), G708 (≠ H545), C710 (= C547), C740 (= C575)
- binding flavin mononucleotide: R487 (= R289), Q488 (≠ S290), Y489 (= Y291), S490 (= S292), Q506 (≠ K307), S511 (≠ G312), R512 (≠ L313), G514 (= G315), S515 (≠ A316), I553 (= I353), E651 (= E472), F653 (= F474)
Sites not aligning to the query:
- active site: 177, 251, 252, 359, 360, 361
- binding carbonate ion: 90, 91, 92, 241
- binding protoporphyrin ix containing fe: 54, 91, 92, 99, 103, 249, 252, 253, 298, 351, 352, 353, 357, 359, 361
5yhiA Crystal structure of yiim from escherichia coli (see paper)
30% identity, 32% coverage: 22:208/586 of query aligns to 8:184/202 of 5yhiA
Q03331 Flavohemoprotein; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Candida norvegensis (Yeast) (Candida mycoderma) (see paper)
26% identity, 38% coverage: 238:460/586 of query aligns to 160:371/390 of Q03331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
28% identity, 40% coverage: 242:477/586 of query aligns to 111:337/337 of 1krhA
- active site: C306 (= C446)
- binding flavin-adenine dinucleotide: Y143 (= Y273), R155 (= R289), S156 (= S290), Y157 (= Y291), S158 (= S292), V171 (≠ S305), V172 (= V306), G178 (= G312), K179 (≠ L313), M180 (≠ A314), S181 (≠ G315), T219 (≠ I353), E332 (= E472), F334 (= F474), S335 (≠ N475), A336 (≠ G476), N337 (≠ G477)
Sites not aligning to the query:
P33164 Phthalate dioxygenase reductase; PDR; EC 1.-.-.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
24% identity, 60% coverage: 235:586/586 of query aligns to 6:322/322 of P33164
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
24% identity, 60% coverage: 235:586/586 of query aligns to 5:321/321 of 2piaA
- binding fe2/s2 (inorganic) cluster: S270 (≠ W537), C272 (= C539), E273 (≠ R540), G275 (= G542), C277 (= C544), G278 (≠ H545), C280 (= C547), C308 (= C574)
- binding flavin mononucleotide: N44 (≠ Y273), R55 (= R289), T56 (≠ S290), Y57 (= Y291), S58 (= S292), A72 (≠ S305), V73 (= V306), G79 (= G312), R80 (≠ L313), G82 (= G315), S83 (≠ A316), I121 (= I353), T124 (= T356), E223 (= E472), F225 (= F474)
6kbhA Crystal structure of an intact type iv self-sufficient cytochrome p450 monooxygenase
24% identity, 58% coverage: 239:576/586 of query aligns to 454:753/765 of 6kbhA
- binding fe2/s2 (inorganic) cluster: C714 (= C539), E715 (≠ R540), G717 (= G542), C719 (= C544), G720 (≠ H545), C722 (= C547), C752 (= C575)
- binding flavin mononucleotide: R499 (= R289), Q500 (≠ S290), Y501 (= Y291), S502 (= S292), A516 (≠ S305), L518 (≠ K307), S523 (≠ G312), R524 (≠ L313), G526 (= G315), S527 (≠ A316), I565 (= I353), T568 (= T356), E663 (= E472), F665 (= F474), I718 (≠ V543)
Sites not aligning to the query:
- active site: 190, 264, 265, 372, 373, 374
- binding protoporphyrin ix containing fe: 67, 104, 105, 112, 116, 261, 262, 265, 266, 308, 311, 313, 364, 365, 370, 372, 373, 374, 378
7ylrA Structure of a bacteria protein
25% identity, 57% coverage: 241:575/586 of query aligns to 8:314/326 of 7ylrA
- binding fe2/s2 (inorganic) cluster: C276 (= C539), K277 (≠ R540), G279 (= G542), C281 (= C544), G282 (≠ H545), C284 (= C547), C314 (= C575)
- binding flavin mononucleotide: R56 (= R289), H57 (≠ S290), Y58 (= Y291), S59 (= S292), A79 (≠ S305), V80 (= V306), R81 (≠ K307), G86 (= G312), R87 (≠ L313), G89 (= G315), S90 (≠ A316), T131 (= T356), E229 (= E472), F231 (= F474), E233 (≠ R494), R278 (≠ T541)
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
27% identity, 41% coverage: 238:475/586 of query aligns to 97:330/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (= Y273), R144 (= R289), Q145 (≠ S290), Y146 (= Y291), S147 (= S292), H161 (≠ S305), V162 (= V306), V165 (≠ E309), G168 (= G312), V169 (≠ L313), A170 (= A314), T171 (vs. gap), T214 (≠ I353), F329 (= F474)
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
27% identity, 41% coverage: 238:475/586 of query aligns to 98:331/334 of P0DPQ8
Sites not aligning to the query:
- 35 binding
- 40 binding
- 43 binding
- 75 binding
- 334 binding
Query Sequence
>H281DRAFT_01789 FitnessBrowser__Burk376:H281DRAFT_01789
MARLLSVNVGLPRDIEWKGRTVYTGIWKSPVQGRCWAARLNLAGDGQGDLAGHGGEQRAV
FVYQTDSYRHWQQELNRSDFVHGQFGENFTVEGLPDALVCVGDRYRIGNALFEVTQPRVT
CYRVGIRMNEPRMPALLTSSGRPGFYLRVVQEGEVGAGDEIVKVGEAEEQMTVAQINALL
YSPDHPLDLLERALRIKALSPGWRSSFEALLQSRTTGAESGNAGLAPAAARHAVQPGFRP
LTVAAIDEESADVVSFTLKSADGQLQPALPGQYLVLRLQPTADGPPLFRSYSLSGPLSAE
SYRISVKIEPNGLAGAWLRSHVHAGDTLDVSSPRGSFVLQPGDGPIVLLSAGIGATPVLA
MLHALSSQQSTRQVLWLHTARDRQHHPFAVEARRLMLALAHGRSYVSYSAAGPNDRLGED
FDATGRLSQQILSEVGVFRDADVYLCGPAPFMADMKKALAALEIAPERIHAETFNGGESL
NPGIVDSQKRTPHRPINEASTGPLVSFARSGIAARWNGSTYQSILELAEACDVPVRWSCR
TGVCHNCESGLVSGSISYDPDPLDPPARGNVLICCCKPQDDVVIDI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory