SitesBLAST
Comparing H281DRAFT_01792 FitnessBrowser__Burk376:H281DRAFT_01792 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
59% identity, 97% coverage: 9:253/253 of query aligns to 6:250/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ G16), R14 (= R17), G15 (= G18), I16 (≠ V19), L36 (≠ V39), R37 (≠ S40), N38 (≠ D41), A61 (= A64), D62 (= D65), V63 (≠ S66), N89 (= N92), A90 (= A93), G91 (≠ A94), T113 (≠ V116), V143 (= V146), S145 (= S148), Y159 (= Y162), K163 (= K166), P189 (= P192), G190 (= G193), I192 (= I195), T194 (= T197), I196 (≠ M199), H197 (= H200)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
53% identity, 98% coverage: 7:253/253 of query aligns to 2:248/248 of 4iqgD
- active site: G13 (= G18), N112 (= N117), S143 (= S148), Y154 (= Y159), Y157 (= Y162), K161 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G14), S11 (≠ G16), R12 (= R17), G13 (= G18), I14 (≠ V19), N32 (≠ S37), A34 (≠ V39), S35 (= S40), N36 (≠ D41), A59 (= A64), D60 (= D65), V61 (≠ S66), N87 (= N92), A88 (= A93), G89 (≠ A94), V141 (= V146), S143 (= S148), Y157 (= Y162), K161 (= K166), P187 (= P192), G188 (= G193), I190 (= I195), T192 (= T197), I194 (≠ M199), H195 (= H200)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
39% identity, 99% coverage: 3:252/253 of query aligns to 2:243/247 of P73574
- A14 (≠ G15) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P156) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K166) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ H194) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ G203) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 98% coverage: 6:252/253 of query aligns to 6:241/244 of 4nbuB
- active site: G18 (= G18), N111 (= N117), S139 (= S148), Q149 (≠ E158), Y152 (= Y162), K156 (= K166)
- binding acetoacetyl-coenzyme a: D93 (≠ Q99), K98 (≠ N104), S139 (= S148), N146 (≠ S155), V147 (≠ P156), Q149 (≠ E158), Y152 (= Y162), F184 (≠ H194), M189 (= M199), K200 (≠ R211)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ R17), G18 (= G18), I19 (≠ V19), D38 (≠ F38), F39 (≠ V39), V59 (≠ A64), D60 (= D65), V61 (≠ S66), N87 (= N92), A88 (= A93), G89 (≠ A94), I90 (= I95), T137 (≠ V146), S139 (= S148), Y152 (= Y162), K156 (= K166), P182 (= P192), F184 (≠ H194), T185 (≠ I195), T187 (= T197), M189 (= M199)
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
31% identity, 96% coverage: 10:252/253 of query aligns to 41:277/282 of 3i3oA
- active site: G49 (= G18), S174 (= S148), L184 (≠ Y159), Y187 (= Y162), K191 (= K166), K232 (≠ G207)
- binding magnesium ion: D47 (≠ G16), S48 (≠ R17), E72 (≠ D41)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G14), D47 (≠ G16), S48 (≠ R17), G49 (= G18), I50 (≠ V19), Y69 (≠ F38), L70 (≠ V39), E72 (≠ D41), G95 (≠ A64), D96 (= D65), L97 (≠ S66), N123 (= N92), V124 (≠ A93), A125 (= A94), Q126 (≠ I95), Q127 (≠ I96), I147 (≠ V116), T172 (≠ V146), S174 (= S148), Y187 (= Y162), K191 (= K166), P217 (= P192), G218 (= G193), I220 (= I195), T222 (= T197), L224 (≠ M199)
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
31% identity, 96% coverage: 10:252/253 of query aligns to 49:285/290 of 3ijrF
- active site: G57 (= G18), S182 (= S148), L192 (≠ Y159), Y195 (= Y162), K199 (= K166), K240 (≠ G207)
- binding magnesium ion: D55 (≠ G16), S56 (≠ R17), E80 (≠ D41)
- binding nicotinamide-adenine-dinucleotide: D55 (≠ G16), S56 (≠ R17), G57 (= G18), I58 (≠ V19), Y77 (≠ F38), L78 (≠ V39), E80 (≠ D41), G103 (≠ A64), D104 (= D65), L105 (≠ S66), N131 (= N92), V132 (≠ A93), A133 (= A94), Q134 (≠ I95), I155 (≠ V116), T180 (≠ V146), S182 (= S148), Y195 (= Y162), K199 (= K166), P225 (= P192), G226 (= G193), P227 (≠ H194), I228 (= I195), T230 (= T197), L232 (≠ M199)
Sites not aligning to the query:
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
35% identity, 98% coverage: 6:252/253 of query aligns to 6:249/261 of 1g6kA
- active site: G18 (= G18), S145 (= S148), Y158 (= Y162), K162 (= K166)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ R17), G18 (= G18), L19 (≠ V19), R39 (≠ V39), D65 (= D65), V66 (≠ S66), N92 (= N92), A93 (= A93), G94 (≠ A94), M143 (≠ V146), S145 (= S148), Y158 (= Y162), P188 (= P192), G189 (= G193), I191 (= I195), T193 (= T197)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
33% identity, 96% coverage: 11:252/253 of query aligns to 8:243/246 of 3osuA
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
35% identity, 98% coverage: 6:252/253 of query aligns to 6:249/261 of P40288
- 11:35 (vs. 11:35, 32% identical) binding
- E96 (≠ I96) mutation E->A,G,K: Heat stable.
- D108 (≠ R109) mutation to N: Heat stable.
- V112 (≠ I113) mutation to A: Heat stable.
- E133 (≠ Y136) mutation to K: Heat stable.
- V183 (= V187) mutation to I: Heat stable.
- P194 (≠ D198) mutation to Q: Heat stable.
- E210 (≠ K213) mutation to K: Heat stable.
- Y217 (≠ R220) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
33% identity, 96% coverage: 11:252/253 of query aligns to 5:236/239 of 3sj7A
- active site: G12 (= G18), S138 (= S148), Q148 (≠ E158), Y151 (= Y162), K155 (= K166)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (≠ G16), R11 (= R17), I13 (≠ V19), N31 (≠ S37), Y32 (≠ F38), A33 (≠ V39), G34 (≠ S40), S35 (≠ D41), A58 (= A64), N59 (≠ D65), V60 (≠ S66), N86 (= N92), A87 (= A93), T109 (≠ V116), S138 (= S148), Y151 (= Y162), K155 (= K166), P181 (= P192), G182 (= G193)
3r3sA Structure of the ygha oxidoreductase from salmonella enterica
35% identity, 96% coverage: 11:253/253 of query aligns to 51:289/292 of 3r3sA
- active site: G58 (= G18), S184 (= S148), L194 (≠ Y159), Y197 (= Y162), K201 (= K166), Q242 (vs. gap)
- binding magnesium ion: D56 (≠ G16), S57 (≠ R17), E82 (≠ D41)
- binding nicotinamide-adenine-dinucleotide: D56 (≠ G16), S57 (≠ R17), G58 (= G18), I59 (≠ V19), L79 (≠ V39), E82 (≠ D41), D106 (= D65), L107 (≠ S66), V133 (≠ I95), A134 (≠ I96), G135 (≠ A97), S184 (= S148), Y197 (= Y162), K201 (= K166), P227 (= P192), G228 (= G193), I230 (= I195), T232 (= T197), L234 (≠ M199), Q235 (≠ H200)
6ypzAAA Monooxygenase (see paper)
37% identity, 96% coverage: 11:252/253 of query aligns to 9:250/253 of 6ypzAAA
- active site: G16 (= G18), S148 (= S148), Y161 (= Y162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ G16), R15 (= R17), G16 (= G18), I17 (≠ V19), H35 (≠ S37), A37 (≠ V39), S38 (= S40), N39 (≠ D41), L64 (≠ S66), N96 (= N92), A97 (= A93), A98 (= A94), T100 (≠ I96), I146 (≠ V146), S147 (= S147), S148 (= S148), Y161 (= Y162), K165 (= K166), P191 (= P192), G192 (= G193), I193 (= I195), T194 (≠ Y196), N196 (≠ D198)
6yq0AAA Monooxygenase (see paper)
37% identity, 96% coverage: 11:252/253 of query aligns to 9:250/254 of 6yq0AAA
- active site: G16 (= G18), S148 (= S148), Y161 (= Y162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ G16), R15 (= R17), G16 (= G18), I17 (≠ V19), H35 (≠ S37), A37 (≠ V39), S38 (= S40), N39 (≠ D41), L64 (≠ S66), N96 (= N92), A97 (= A93), A98 (= A94), T100 (≠ I96), R117 (= R112), I146 (≠ V146), S147 (= S147), S148 (= S148), Y161 (= Y162), K165 (= K166), P191 (= P192), G192 (= G193), I193 (= I195), T194 (≠ Y196), N196 (≠ D198)
- binding (3~{R})-8-methoxy-3-methyl-3-oxidanyl-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: T100 (≠ I96), G101 (≠ A97), S148 (= S148), G149 (≠ A149), L150 (≠ S150), C153 (≠ L153), Q158 (≠ Y159), Y161 (= Y162), G192 (= G193), I193 (= I195)
Sites not aligning to the query:
P0AG84 Uncharacterized oxidoreductase YghA; EC 1.-.-.- from Escherichia coli (strain K12) (see paper)
34% identity, 96% coverage: 11:253/253 of query aligns to 53:291/294 of P0AG84
Sites not aligning to the query:
- 39 modified: N6-acetyllysine
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
35% identity, 96% coverage: 11:252/253 of query aligns to 10:248/252 of 1vl8B
- active site: G17 (= G18), S143 (= S148), I154 (≠ Y159), Y157 (= Y162), K161 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), R16 (= R17), G17 (= G18), L18 (≠ V19), S37 (≠ F38), R38 (≠ V39), C63 (≠ A64), D64 (= D65), V65 (≠ S66), A91 (≠ N92), A92 (= A93), G93 (≠ A94), I94 (= I95), V114 (= V116), I141 (≠ V146), S143 (= S148), Y157 (= Y162), K161 (= K166), P187 (= P192), G188 (= G193), Y190 (≠ I195), T192 (= T197), M194 (= M199), T195 (vs. gap)
6oz7A Putative oxidoreductase from escherichia coli str. K-12
36% identity, 96% coverage: 11:252/253 of query aligns to 5:231/242 of 6oz7A
6yq3AAA Monooxygenase (see paper)
37% identity, 96% coverage: 11:252/253 of query aligns to 9:248/252 of 6yq3AAA
- active site: G16 (= G18), S146 (= S148), Y159 (= Y162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ G16), R15 (= R17), G16 (= G18), I17 (≠ V19), H35 (≠ S37), A37 (≠ V39), S38 (= S40), N39 (≠ D41), L64 (≠ S66), N96 (= N92), A97 (= A93), A98 (= A94), V119 (= V116), I144 (≠ V146), Y159 (= Y162), K163 (= K166), P189 (= P192), G190 (= G193), I191 (= I195), T192 (≠ Y196), N194 (≠ D198)
- binding (3~{R})-8-methoxy-3-methyl-3,6-bis(oxidanyl)-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: S146 (= S148), G147 (≠ A149), L148 (≠ S150), Q156 (≠ Y159), Y159 (= Y162), I191 (= I195)
Sites not aligning to the query:
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
33% identity, 98% coverage: 6:252/253 of query aligns to 4:242/245 of 5wuwA
- active site: G16 (= G18), S140 (= S148), Y154 (= Y162), L161 (≠ V169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), R15 (= R17), I17 (≠ V19), Y36 (≠ F38), A37 (≠ V39), A38 (≠ S40), D63 (= D65), S64 (= S66), N90 (= N92), A91 (= A93), G92 (≠ A94), Y154 (= Y162), K158 (= K166), G185 (= G193), P186 (≠ H194), V187 (≠ I195)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
35% identity, 97% coverage: 7:252/253 of query aligns to 1:241/244 of 1edoA
- active site: G12 (= G18), S138 (= S148), Y151 (= Y162), K155 (= K166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (≠ G16), R11 (= R17), I13 (≠ V19), N31 (≠ S37), Y32 (≠ F38), A33 (≠ V39), R34 (≠ S40), S35 (≠ D41), D59 (= D65), V60 (vs. gap), N86 (= N92), A87 (= A93), S138 (= S148), Y151 (= Y162), K155 (= K166), P181 (= P192), G182 (= G193), I184 (= I195), S186 (≠ T197), M188 (= M199)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
34% identity, 96% coverage: 11:252/253 of query aligns to 15:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G14), S20 (≠ G16), K21 (≠ R17), G22 (= G18), I23 (≠ V19), A43 (≠ V39), S44 (= S40), S45 (≠ D41), G68 (≠ A64), D69 (= D65), V70 (≠ S66), N96 (= N92), S97 (≠ A93), G98 (≠ A94), Y100 (≠ I96), I144 (≠ V146), S146 (= S148), Y159 (= Y162), K163 (= K166), P189 (= P192), G190 (= G193), M191 (≠ H194), I192 (= I195), T194 (= T197), G196 (≠ M199), T197 (≠ H200)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S148), Y159 (= Y162), M191 (≠ H194), I202 (≠ E205)
Query Sequence
>H281DRAFT_01792 FitnessBrowser__Burk376:H281DRAFT_01792
MNTVSQAPLILITGGGRGVGAATARLAAAQGYDVAISFVSDESAAHAVAADVEAVGRRAL
AVRADSADPEQVAQLFAAIDQKFGRIDVLVNNAAIIAQQSALENLEFARMQRIFAVNAIG
PILCAQQAVKRMSYRYKGRGGVVINVSSASARLGSPNEYVDYAASKGAVETFTTGFAKEV
ARDGIRVNCIRPGHIYTDMHASGGEPGRVDRVKDSIPMGRGGQPEEVARAILWLASEEAS
FITGTFLDVTGGK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory