Comparing H281DRAFT_01829 FitnessBrowser__Burk376:H281DRAFT_01829 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
26% identity, 67% coverage: 10:224/319 of query aligns to 1:209/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
26% identity, 67% coverage: 10:224/319 of query aligns to 1:209/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
26% identity, 67% coverage: 10:224/319 of query aligns to 1:209/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
26% identity, 67% coverage: 10:224/319 of query aligns to 1:209/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
26% identity, 67% coverage: 10:224/319 of query aligns to 1:209/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
26% identity, 67% coverage: 10:224/319 of query aligns to 1:209/291 of 3pueB
Sites not aligning to the query:
4pfmA Shewanella benthica dhdps with lysine and pyruvate
27% identity, 70% coverage: 11:232/319 of query aligns to 3:218/295 of 4pfmA
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
29% identity, 44% coverage: 12:150/319 of query aligns to 3:136/294 of 4i7wA
Sites not aligning to the query:
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
29% identity, 44% coverage: 12:150/319 of query aligns to 3:136/294 of Q8UGL3
Sites not aligning to the query:
5c55A Crystal structure of the y138f mutant of c.Glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
26% identity, 56% coverage: 10:188/319 of query aligns to 1:175/307 of 5c55A
Sites not aligning to the query:
Q1JUQ0 L-2-keto-3-deoxyarabonate dehydratase; L-KDA dehydratase; 2-dehydro-3-deoxy-L-arabinonate dehydratase; L-2-keto-3-deoxyarabinonate dehydratase; EC 4.2.1.43 from Azospirillum brasilense (see paper)
42% identity, 23% coverage: 13:85/319 of query aligns to 11:83/309 of Q1JUQ0
Sites not aligning to the query:
2wpbA Crystal structure of the e192n mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4- trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i (see paper)
27% identity, 55% coverage: 10:186/319 of query aligns to 9:181/302 of 2wpbA
Sites not aligning to the query:
3lbcD D-sialic acid aldolase complexed with l-arabinose
27% identity, 55% coverage: 10:186/319 of query aligns to 4:176/296 of 3lbcD
Sites not aligning to the query:
8u8wA Crystal structure of n-acetylneuraminate lyase (nana) from klebsiella aerogenes (pyruvate and halides bound)
25% identity, 70% coverage: 11:232/319 of query aligns to 6:219/297 of 8u8wA
1fdzA N-acetylneuraminate lyase in complex with pyruvate via borohydride reduction (see paper)
27% identity, 55% coverage: 10:186/319 of query aligns to 1:173/292 of 1fdzA
Sites not aligning to the query:
1fdyA N-acetylneuraminate lyase in complex with hydroxypyruvate (see paper)
27% identity, 55% coverage: 10:186/319 of query aligns to 1:173/292 of 1fdyA
Sites not aligning to the query:
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
25% identity, 66% coverage: 13:223/319 of query aligns to 5:209/293 of 5t25A
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
27% identity, 67% coverage: 11:223/319 of query aligns to 2:208/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
27% identity, 67% coverage: 11:223/319 of query aligns to 2:208/292 of 3puoA
Sites not aligning to the query:
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
25% identity, 66% coverage: 13:223/319 of query aligns to 4:208/292 of 2atsA
>H281DRAFT_01829 FitnessBrowser__Burk376:H281DRAFT_01829
MTIAKPPTVSIEGIVPVMLTPFDDSGAIDYAGLERLIEWYLAQGSDALFAVAQSSEMQFL
TLAERGALGRFVVEKVAGRIPVVVSGHISDDPDAQAEELNVAAATGAQAIVLVTNRLDPA
REGMQAFAANLKRLLARLPSDLPLGLYECPAPYRRLLSDDELKLCIDTGRFIMLKDVSCD
LATVKRRVALAQGSPLKILNANAAIAWDAMKAGSAGFNGVFTNFHTDLYKWLRNDATRDP
ALADELATFLVLAAVSESLGYPALAKMYHQRIGTFNSIRCRVIDYDVRERFWALDAILDK
IVAGTEHFRARIAALDSSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory