SitesBLAST
Comparing H281DRAFT_01831 H281DRAFT_01831 DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
38% identity, 91% coverage: 25:400/414 of query aligns to 20:394/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: R23 (= R28), G40 (= G45), L41 (≠ Y46)
- binding 2-oxoglutaric acid: D213 (= D215), P214 (= P216), Y215 (= Y217), G216 (= G218), E217 (≠ D219), G241 (≠ A248), T242 (≠ S249), I246 (= I253)
- binding (2E)-pent-2-enedioic acid: G40 (= G45), Y130 (= Y134), N184 (= N186), R376 (= R382)
- binding glutamic acid: S20 (= S25), V22 (≠ I27), L131 (≠ P135), V360 (= V366), A364 (= A370), R369 (= R375)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G108), S105 (= S109), Q106 (= Q110), Y130 (= Y134), N184 (= N186), D212 (= D214), P214 (= P216), Y215 (= Y217), T242 (≠ S249), S244 (= S251), K245 (= K252), R252 (= R259)
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
38% identity, 91% coverage: 25:400/414 of query aligns to 20:394/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: S20 (= S25), V22 (≠ I27), R23 (= R28), L131 (≠ P135), Q135 (= Q139), A364 (= A370), R369 (= R375)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: R23 (= R28), G40 (= G45), Y130 (= Y134), L131 (≠ P135), A132 (= A136), N184 (= N186), R376 (= R382)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G108), S105 (= S109), Q106 (= Q110), Y130 (= Y134), V179 (= V181), N184 (= N186), D212 (= D214), P214 (= P216), Y215 (= Y217), T242 (≠ S249), S244 (= S251), K245 (= K252), R252 (= R259)
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
38% identity, 91% coverage: 25:400/414 of query aligns to 20:394/404 of 3aowC
- binding 2-oxoglutaric acid: R23 (= R28), Y70 (= Y74), Y130 (= Y134), L275 (= L282)
- binding pyridoxal-5'-phosphate: G104 (= G108), S105 (= S109), Q106 (= Q110), Y130 (= Y134), V179 (= V181), N184 (= N186), D212 (= D214), P214 (= P216), Y215 (= Y217), T242 (≠ S249), S244 (= S251), K245 (= K252), R252 (= R259)
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
38% identity, 91% coverage: 25:400/414 of query aligns to 20:394/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G108), S105 (= S109), Q106 (= Q110), Y130 (= Y134), V179 (= V181), N184 (= N186), D212 (= D214), P214 (= P216), Y215 (= Y217), T242 (≠ S249), S244 (= S251), K245 (= K252), R252 (= R259)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
39% identity, 91% coverage: 23:400/414 of query aligns to 15:392/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G108), S103 (= S109), Q104 (= Q110), Y128 (= Y134), V177 (= V181), N182 (= N186), D210 (= D214), P212 (= P216), Y213 (= Y217), T240 (≠ S249), S242 (= S251), K243 (= K252), R250 (= R259)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
38% identity, 92% coverage: 25:403/414 of query aligns to 20:389/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I22 (= I27), R23 (= R28), G39 (= G44), G40 (= G45), G99 (= G108), S100 (= S109), Q101 (= Q110), Y125 (= Y134), N174 (= N186), D202 (= D214), Y205 (= Y217), S235 (= S249), S237 (= S251), K238 (= K252), R245 (= R259), R368 (= R382)
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
38% identity, 92% coverage: 25:403/414 of query aligns to 20:389/397 of Q72LL6
- S20 (= S25) mutation to E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- R23 (= R28) mutation to A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; mutation to Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- G40 (= G45) binding
- Y70 (= Y74) binding
- N174 (= N186) binding ; binding
- R245 (= R259) binding
- R368 (= R382) binding
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
38% identity, 92% coverage: 25:403/414 of query aligns to 16:385/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: I18 (= I27), R19 (= R28), G35 (= G44), G36 (= G45), G95 (= G108), S96 (= S109), Q97 (= Q110), Y121 (= Y134), N170 (= N186), D198 (= D214), Y201 (= Y217), S231 (= S249), S233 (= S251), K234 (= K252), R241 (= R259), R364 (= R382)
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
38% identity, 92% coverage: 25:403/414 of query aligns to 16:385/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G108), S96 (= S109), Q97 (= Q110), Y121 (= Y134), N170 (= N186), D198 (= D214), A200 (≠ P216), Y201 (= Y217), S231 (= S249), S233 (= S251), K234 (= K252), R241 (= R259)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
35% identity, 93% coverage: 20:403/414 of query aligns to 21:409/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G108), S113 (= S109), Q114 (= Q110), Y138 (= Y134), N194 (= N186), D222 (= D214), P224 (= P216), Y225 (= Y217), T252 (≠ S249), S254 (= S251), K255 (= K252), R262 (= R259)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
38% identity, 92% coverage: 25:403/414 of query aligns to 17:381/389 of 2z1yA
- binding leucine: G32 (= G45), Y117 (= Y134), R360 (= R382)
- binding pyridoxal-5'-phosphate: G91 (= G108), S92 (= S109), Q93 (= Q110), Y117 (= Y134), N166 (= N186), D194 (= D214), Y197 (= Y217), S227 (= S249), S229 (= S251), K230 (= K252), R237 (= R259)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
35% identity, 88% coverage: 39:404/414 of query aligns to 36:401/405 of 2zc0A
- active site: Y132 (= Y134), D214 (= D214), A216 (≠ P216), S246 (= S251)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G108), G107 (≠ S109), T108 (≠ Q110), Y132 (= Y134), N186 (= N186), D214 (= D214), A216 (≠ P216), Y217 (= Y217), T244 (≠ S249), S246 (= S251), K247 (= K252), R254 (= R259)
5tf5A Crystal structure of human kat-2 in complex with a reversible inhibitor
32% identity, 89% coverage: 20:387/414 of query aligns to 14:404/425 of 5tf5A
2r2nA The crystal structure of human kynurenine aminotransferase ii in complex with kynurenine (see paper)
32% identity, 89% coverage: 20:387/414 of query aligns to 14:404/425 of 2r2nA
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: I19 (= I27), R20 (= R28), Y142 (= Y134), R399 (= R382)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S117 (= S109), Q118 (= Q110), Y142 (= Y134), N202 (= N186), D230 (= D214), P232 (= P216), Y233 (= Y217), S260 (= S249), S262 (= S251), K263 (= K252), R270 (= R259)
6t8qA Hkatii in complex with ligand (2r)-n-benzyl-1-[6-methyl-5-(oxan-4-yl)- 7-oxo-6h,7h-[1,3]thiazolo[5,4-d]pyrimidin-2-yl]pyrrolidine-2- carboxamide (see paper)
32% identity, 89% coverage: 20:387/414 of query aligns to 17:407/428 of 6t8qA
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
32% identity, 89% coverage: 20:387/414 of query aligns to 14:404/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (= G45), L40 (≠ Y46), Y74 (= Y74), S117 (= S109), Q118 (= Q110), Y142 (= Y134), N202 (= N186), D230 (= D214), P232 (= P216), Y233 (= Y217), S260 (= S249), S262 (= S251), K263 (= K252), R270 (= R259), R399 (= R382)
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
32% identity, 89% coverage: 20:387/414 of query aligns to 14:404/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I27), R20 (= R28), T23 (≠ F31), G39 (= G45), L40 (≠ Y46), Y74 (= Y74), S75 (≠ G75), S77 (≠ T77), S117 (= S109), Q118 (= Q110), Y142 (= Y134), N202 (= N186), D230 (= D214), P232 (= P216), Y233 (= Y217), S260 (= S249), S262 (= S251), R270 (= R259), L293 (= L282), R399 (= R382)
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
32% identity, 89% coverage: 20:387/414 of query aligns to 14:404/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I27), G39 (= G45), Y74 (= Y74), S75 (≠ G75), S77 (≠ T77), S117 (= S109), Q118 (= Q110), Y142 (= Y134), N202 (= N186), D230 (= D214), P232 (= P216), Y233 (= Y217), S260 (= S249), S262 (= S251), R270 (= R259), L293 (= L282), R399 (= R382)
4gdyB Kynurenine aminotransferase ii inhibitors
32% identity, 89% coverage: 20:387/414 of query aligns to 14:404/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: I19 (= I27), M33 (= M39), G39 (= G45), Y74 (= Y74), S75 (≠ G75), G116 (= G108), S117 (= S109), Q118 (= Q110), Y142 (= Y134), N202 (= N186), D230 (= D214), P232 (= P216), S260 (= S249), S262 (= S251), R270 (= R259), R399 (= R382)
4ge4A Kynurenine aminotransferase ii inhibitors (see paper)
32% identity, 89% coverage: 20:387/414 of query aligns to 14:398/422 of 4ge4A
- binding (5-hydroxy-4-{[(1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I27), G34 (= G44), G35 (= G45), L36 (≠ Y46), Y68 (= Y74), G110 (= G108), S111 (= S109), Q112 (= Q110), Y136 (= Y134), N196 (= N186), D224 (= D214), P226 (= P216), Y227 (= Y217), S254 (= S249), S256 (= S251), K257 (= K252), R264 (= R259), R393 (= R382)
Query Sequence
>H281DRAFT_01831 H281DRAFT_01831 DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain
MRDDLGSAAENMYEFTAPFQNPSGSPIRELFKYLGEPGMISFAGGYPASDLFDVDGLQQA
EARAYQDPNSCLQYGPTDGLPRLKHELISLMARRGVPCALNEMLVTTGSQQGLDLLLRVL
VSPGDVVFTEQPAYPATLQALKLQQAKIVTVPVDAHGLDVDHLAELLASGRVARPKLLYT
VPTFANPTGATITRERRIALLKLAVQYKFLIVEDDPYGDLRFSGVAVPSIISLAAEVEGS
RDWVVHFASLSKIVAPGLRVGWTIAPAEITRRCVIAKQTVDLCSAPWTQAIAAEYLADGA
LERHLPRITEMYGRKCEALCEALRSQFGDTLQFHRPDGGMFVWARIEGIDASALLQHAIE
NKVMFVPGKAFFADRIDPASLRLSFAAPGIADIEEGAKRLRRAYDTAARNVVLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory