Comparing H281DRAFT_01970 FitnessBrowser__Burk376:H281DRAFT_01970 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
49% identity, 100% coverage: 1:213/214 of query aligns to 3:213/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
49% identity, 100% coverage: 1:213/214 of query aligns to 1:211/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
49% identity, 100% coverage: 1:213/214 of query aligns to 1:211/212 of O86043
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
48% identity, 99% coverage: 3:213/214 of query aligns to 8:210/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
48% identity, 99% coverage: 3:213/214 of query aligns to 5:207/212 of 2cz2A
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
48% identity, 99% coverage: 3:213/214 of query aligns to 4:206/208 of 1fw1A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
47% identity, 99% coverage: 3:213/214 of query aligns to 8:210/216 of O43708
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
44% identity, 100% coverage: 1:213/214 of query aligns to 3:214/216 of 4pxoA
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
40% identity, 100% coverage: 1:213/214 of query aligns to 10:214/222 of 4kdyA
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
40% identity, 100% coverage: 1:213/214 of query aligns to 8:212/220 of 4kaeA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
37% identity, 96% coverage: 1:205/214 of query aligns to 6:217/231 of D2YW48
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
37% identity, 96% coverage: 1:205/214 of query aligns to 4:215/228 of 3n5oA
7dweA Crystal structure of a glutathione s-transferase sbgstu7 from salix babylonica in complex with glutathione
35% identity, 60% coverage: 1:129/214 of query aligns to 3:123/212 of 7dweA
7zvpA Crystal structure of poplar glutathione transferase u19 in complex with glutathione (see paper)
38% identity, 44% coverage: 1:95/214 of query aligns to 3:93/216 of 7zvpA
8a0pA Crystal structure of poplar glutathione transferase u20 in complex with morin (see paper)
37% identity, 44% coverage: 1:95/214 of query aligns to 3:93/216 of 8a0pA
Sites not aligning to the query:
8a0rA Crystal structure of poplar glutathione transferase u20 in complex with pinocembrin (see paper)
37% identity, 44% coverage: 1:95/214 of query aligns to 2:92/215 of 8a0rA
Sites not aligning to the query:
8a0qA Crystal structure of poplar glutathione transferase u20 in complex with baicalein (see paper)
37% identity, 44% coverage: 1:95/214 of query aligns to 2:92/215 of 8a0qA
Sites not aligning to the query:
8a0oA Crystal structure of poplar glutathione transferase u20 in complex with galangin (see paper)
37% identity, 44% coverage: 1:95/214 of query aligns to 2:92/215 of 8a0oA
Sites not aligning to the query:
8a0iA Crystal structure of poplar glutathione transferase u20 in complex with glutathionylphenylacetophenone (see paper)
37% identity, 44% coverage: 1:95/214 of query aligns to 2:92/215 of 8a0iA
Sites not aligning to the query:
8a08A Crystal structure of poplar glutathione transferase u20 in complex with glutathione (see paper)
37% identity, 44% coverage: 1:95/214 of query aligns to 2:92/215 of 8a08A
>H281DRAFT_01970 FitnessBrowser__Burk376:H281DRAFT_01970
MKLYSYFRSSASYRVRIALNVKNLPYEYVPVHLVRDGGEQLKPEYRAVNVDGIVPTLIDG
HEVMPQSLAIIEYLEETHPEPPLLPKAPADRAYVRSLALQVACEIHPLNNLRVLKYLKHT
LRVENDAKDAWYRHWVDTGFATLEAHLASDGRTGKLCFGDEPTLADACLIPQVFNAQRFN
VDTSKYPTIQRIYDHAMQIDAFARAAPGVQPDAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory