Comparing H281DRAFT_02007 FitnessBrowser__Burk376:H281DRAFT_02007 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
38% identity, 93% coverage: 5:548/582 of query aligns to 4:538/570 of 2wqdA
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
38% identity, 94% coverage: 5:551/582 of query aligns to 5:540/573 of P23533
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 97% coverage: 5:567/582 of query aligns to 2:564/575 of P08839
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
38% identity, 97% coverage: 5:567/582 of query aligns to 1:563/572 of 2hwgA
2xz7A Crystal structure of the phosphoenolpyruvate-binding domain of enzyme i in complex with phosphoenolpyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
44% identity, 55% coverage: 259:581/582 of query aligns to 5:322/324 of 2xz7A
2xz9A Crystal structure from the phosphoenolpyruvate-binding domain of enzyme i in complex with pyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
44% identity, 55% coverage: 262:581/582 of query aligns to 1:315/317 of 2xz9A
O23404 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 74% coverage: 116:545/582 of query aligns to 461:954/963 of O23404
5lu4A C4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism (see paper)
28% identity, 67% coverage: 156:545/582 of query aligns to 419:844/850 of 5lu4A
Sites not aligning to the query:
5jvjB C4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer (see paper)
27% identity, 67% coverage: 156:545/582 of query aligns to 346:789/797 of 5jvjB
Sites not aligning to the query:
1vbgA Pyruvate phosphate dikinase from maize (see paper)
27% identity, 74% coverage: 117:545/582 of query aligns to 373:866/874 of 1vbgA
Sites not aligning to the query:
5jvlA C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
27% identity, 67% coverage: 156:545/582 of query aligns to 419:866/874 of 5jvlA
Sites not aligning to the query:
Q39735 Pyruvate, phosphate dikinase, chloroplastic; Cold-sensitive pyruvate, orthophosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Flaveria bidentis (Coastal plain yellowtops) (Ethulia bidentis) (see 2 papers)
26% identity, 76% coverage: 104:545/582 of query aligns to 436:945/953 of Q39735
Sites not aligning to the query:
P11155 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Zea mays (Maize) (see 7 papers)
27% identity, 74% coverage: 117:545/582 of query aligns to 446:939/947 of P11155
Sites not aligning to the query:
Q02KR1 Phosphoenolpyruvate synthase; PEP synthase; Pyruvate, water dikinase; EC 2.7.9.2 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
27% identity, 61% coverage: 186:542/582 of query aligns to 409:778/791 of Q02KR1
1vbhA Pyruvate phosphate dikinase with bound mg-pep from maize (see paper)
26% identity, 74% coverage: 117:545/582 of query aligns to 364:854/862 of 1vbhA
Sites not aligning to the query:
5jvlB C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
29% identity, 47% coverage: 274:545/582 of query aligns to 180:512/520 of 5jvlB
Sites not aligning to the query:
1kc7A Pyruvate phosphate dikinase with bound mg-phosphonopyruvate (see paper)
25% identity, 69% coverage: 135:538/582 of query aligns to 389:855/872 of 1kc7A
Sites not aligning to the query:
P22983 Pyruvate, phosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
25% identity, 69% coverage: 135:538/582 of query aligns to 390:856/874 of P22983
Sites not aligning to the query:
P37349 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Escherichia coli (strain K12) (see paper)
27% identity, 29% coverage: 39:205/582 of query aligns to 278:440/472 of P37349
Sites not aligning to the query:
5fbtA Crystal structure of rifampin phosphotransferase rph-lm from listeria monocytogenes in complex with rifampin (see paper)
38% identity, 9% coverage: 181:233/582 of query aligns to 713:765/769 of 5fbtA
Sites not aligning to the query:
>H281DRAFT_02007 FitnessBrowser__Burk376:H281DRAFT_02007
VSFTLHGIPVSRGIAIGRAYLIAPAALDVDHYLIEPAQIESEVERFRAAQQRVHEELDAL
RADLAADAPSEMGAFINVHSMILNDAMLVQETIDLIRTRRYNVEWALTEQLERLSRHFDD
IEDEYLRERKADIEQVVERVLKALAGASGSLVNGVHGACDEMIVVAHDIAPADMMQFKTQ
TFQGFVTDLGGRTSHTAIVARSLGIPAAVGVQHASALIRQDDLIIVDGDHGIVIVDPAPI
VLEEYSYRQSEKALEQRKLQRLKFSPTQTLCGTRIELCANIELPEDARAAVDAGATGVGL
FRTEFLFMNHKHRMPEEEEQFEAYRRAVELMNGLPVTIRTIDVGADKPLDSMSGGDGYET
AANPALGLRAIRWSLSEPQMFLTQLRAILRASAFGTVKILVPMLAHAQEIDQTLDLIREA
KRQLDDAGIAYDPNVQVGAMIEIPAAAIALPLFLKRLDFLSIGTNDLIQYTLAIDRADNS
VAHLYDPLHPAVLHLIAFTLREAKRAGVPVSVCGEMAGDPSLTRLLLGMGLTEFSMHPSQ
LLVVKQEVLRSHLKTLEKPVADVLASFEPEEVQAALKRVAQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory