SitesBLAST
Comparing H281DRAFT_02039 FitnessBrowser__Burk376:H281DRAFT_02039 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
30% identity, 92% coverage: 18:424/443 of query aligns to 8:421/425 of O59010
- S65 (≠ T73) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S284) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 284:286) binding
- M311 (≠ L319) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T322) binding
- V355 (= V363) binding
- D394 (≠ S397) binding
- M395 (≠ E398) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R400) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N404) binding
- D405 (≠ N408) mutation to N: Strongly decreased affinity for aspartate.
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
30% identity, 92% coverage: 22:429/443 of query aligns to 9:424/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
30% identity, 92% coverage: 22:429/443 of query aligns to 8:423/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ G204), G195 (≠ I208), R282 (vs. gap)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S284), S272 (= S285), S273 (= S286), M307 (≠ L319), T310 (= T322), G353 (= G365), A354 (= A366), R394 (= R400), T395 (≠ A401)
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
30% identity, 92% coverage: 22:429/443 of query aligns to 11:426/427 of 5e9sA
- binding aspartic acid: R274 (≠ S284), S275 (= S285), S276 (= S286), T313 (= T322), G353 (= G362), V354 (= V363), A357 (= A366), G358 (= G367), D394 (≠ S397), R397 (= R400), T398 (≠ A401)
- binding decyl-beta-d-maltopyranoside: L194 (≠ G204), G198 (≠ I208), Y202 (≠ L212)
- binding sodium ion: Y87 (≠ F98), T90 (≠ V101), S91 (= S102), S276 (= S286), G305 (= G314), A306 (≠ Y315), T307 (≠ S316), N309 (= N318), N309 (= N318), M310 (≠ L319), D311 (= D320), S348 (= S357), I349 (≠ K358), G350 (= G359), T351 (≠ A360), N401 (= N404), V402 (≠ I405), D405 (≠ N408)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
30% identity, 92% coverage: 22:429/443 of query aligns to 11:426/426 of 6xwnB
2nwwA Crystal structure of gltph in complex with tboa (see paper)
30% identity, 90% coverage: 21:419/443 of query aligns to 2:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
29% identity, 91% coverage: 18:422/443 of query aligns to 8:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L54), F46 (≠ L54), P75 (≠ D83), L91 (≠ I100), F95 (= F104), L130 (≠ T146), I133 (≠ F149), I159 (≠ L175), Y167 (≠ A179), K196 (≠ G204), G200 (≠ I208), I207 (= I215), F210 (= F218), L250 (≠ I258), I262 (= I270), M269 (= M277), T334 (= T342), V335 (≠ W343), G336 (≠ A344), T340 (= T348), L343 (≠ A351), M399 (≠ L402)
- binding aspartic acid: S277 (= S285), S278 (= S286), T314 (= T322), G354 (= G362), A358 (= A366), G359 (= G367), D394 (≠ S397), R397 (= R400), T398 (≠ A401)
- binding sodium ion: Y89 (≠ F98), T92 (≠ V101), S93 (= S102), G306 (= G314), T308 (≠ S316), N310 (= N318), N310 (= N318), M311 (≠ L319), D312 (= D320), S349 (= S357), I350 (≠ K358), T352 (≠ A360), N401 (= N404), V402 (≠ I405), D405 (≠ N408)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
29% identity, 92% coverage: 22:429/443 of query aligns to 4:415/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S284), S265 (= S286), M299 (≠ L319), T302 (= T322), T340 (≠ A360), G342 (= G362), V343 (= V363), G347 (= G367), D383 (≠ S397), R386 (= R400), T387 (≠ A401), N390 (= N404)
- binding decyl-beta-d-maltopyranoside: H23 (= H42), V212 (≠ L233), A216 (≠ L237)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
29% identity, 91% coverage: 18:419/443 of query aligns to 5:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G77), V83 (≠ L95), I157 (≠ L176), Y164 (≠ A179), K193 (≠ G204), T305 (≠ S316), I306 (≠ F317), I347 (≠ K358)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L26), M199 (≠ T210), S275 (= S286), T311 (= T322), G356 (= G367), L384 (= L390), D391 (≠ S397), R394 (= R400)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
29% identity, 91% coverage: 19:419/443 of query aligns to 1:408/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
29% identity, 91% coverage: 19:419/443 of query aligns to 1:408/408 of 6bauA
- binding cysteine: S270 (= S286), M303 (≠ L319), T306 (= T322), A345 (≠ S361), G346 (= G362), V347 (= V363), G351 (= G367), D386 (≠ S397), C389 (≠ R400), T390 (≠ A401), N393 (= N404)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
28% identity, 91% coverage: 19:419/443 of query aligns to 1:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
29% identity, 84% coverage: 55:426/443 of query aligns to 57:410/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V87), G89 (= G88), G92 (= G91), A95 (= A94), V96 (≠ L95), Y99 (≠ F98), M163 (≠ L175), F167 (≠ A179), F293 (≠ L309), V297 (≠ T313)
- binding aspartic acid: S268 (= S285), S269 (= S286), T306 (= T322), G346 (= G362), I347 (≠ V363), A350 (= A366), G351 (= G367), D380 (≠ S397), R383 (= R400), T384 (≠ A401)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
29% identity, 84% coverage: 55:426/443 of query aligns to 49:396/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I78), S80 (≠ V87), G81 (= G88), G84 (= G91), Y91 (≠ F98), M156 (≠ L175), F160 (≠ A179), F286 (≠ L309), V290 (≠ T313)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I70), I148 (= I167), S262 (= S286), S263 (≠ E287), A292 (≠ Y315), T293 (≠ S316), M296 (≠ L319), T299 (= T322), G329 (= G359), A336 (= A366), G337 (= G367), D366 (≠ S397), R369 (= R400), N373 (= N404)
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
28% identity, 80% coverage: 72:424/443 of query aligns to 60:429/433 of 8cv2A
- binding sodium ion: Y85 (≠ F98), T88 (≠ V101), T89 (≠ S102), G319 (= G314), A320 (≠ Y315), N323 (= N318), N323 (= N318), M324 (≠ L319), D325 (= D320), N408 (= N404), D412 (≠ N408)
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
28% identity, 81% coverage: 73:429/443 of query aligns to 61:416/416 of 8cuaA
6x2zA Heaat3-ofs-asp (see paper)
27% identity, 79% coverage: 73:424/443 of query aligns to 59:416/419 of 6x2zA
- binding aspartic acid: S275 (= S284), S277 (= S286), T314 (= T322), G354 (= G362), V355 (= V363), D388 (≠ S397), R391 (= R400), T392 (≠ A401)
- binding sodium ion: Y83 (≠ F98), T86 (≠ V101), T87 (≠ S102), G306 (= G314), A307 (≠ Y315), T308 (≠ S316), I309 (≠ F317), N310 (= N318), N310 (= N318), M311 (≠ L319), M311 (≠ L319), D312 (= D320), S349 (= S357), I350 (≠ K358), G351 (= G359), A352 (= A360), N395 (= N404), D399 (≠ N408)
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
27% identity, 90% coverage: 30:426/443 of query aligns to 58:505/543 of P56564
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
28% identity, 79% coverage: 73:424/443 of query aligns to 65:426/430 of 7nsgA
- binding (+)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: S287 (= S286), D398 (≠ S397), R401 (= R400), T402 (≠ A401), N405 (= N404)
- binding (-)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: P366 (≠ T364), D398 (≠ S397), R401 (= R400), T402 (≠ A401)
- binding cholesterol hemisuccinate: I258 (≠ V254), L419 (≠ W418)
6s3qA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with tfb-tboa
28% identity, 79% coverage: 73:424/443 of query aligns to 65:426/430 of 6s3qA
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: S286 (= S285), S287 (= S286), T324 (= T322), A358 (≠ T356), G361 (= G359), V365 (= V363), A368 (= A366), T372 (= T370), D398 (≠ S397), R401 (= R400), T402 (≠ A401), N405 (= N404)
- binding cholesterol hemisuccinate: K80 (≠ R89), R84 (≠ K93)
Query Sequence
>H281DRAFT_02039 FitnessBrowser__Burk376:H281DRAFT_02039
MMRSVAGHRLTHIAGTIVKKPIHKVLYVQVIVAIIIGIALGHYYPNLAVDMKPLGDGFIK
LIKMVIGPIIFCTVVTGIAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLIATHVLKPGV
GFNIDPATLDGKAVASYAAKAHGQTTVDFLMHLIPDTLVSAFAQGEILQILLIALLFGAV
LATAGERGKVVTNFIEGLSHVLFGIVRIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKLI
GTFYLTSIVFVVVVLGIIARAVGFNILRFIAYIKEEMLIVLGTSSSEAALPQLMLKLENL
GCSRSVVGLVVPTGYSFNLDGTNIYMTMAVLFIAQATNTDLTWAQQLTLLAVTMLTSKGA
SGVTGAGFITLAATLAVVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEK
ELDRNKLNSALRGDVPVKEPAGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory