Comparing H281DRAFT_02073 FitnessBrowser__Burk376:H281DRAFT_02073 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
36% identity, 97% coverage: 5:258/262 of query aligns to 6:259/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 99% coverage: 1:260/262 of query aligns to 2:265/268 of 6eb3B
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
29% identity, 96% coverage: 9:260/262 of query aligns to 14:269/272 of 4uheA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
29% identity, 96% coverage: 9:260/262 of query aligns to 14:269/274 of 4uhdA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
29% identity, 96% coverage: 9:260/262 of query aligns to 14:269/278 of 4uhfA
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 99% coverage: 1:260/262 of query aligns to 2:262/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 99% coverage: 1:260/262 of query aligns to 2:259/262 of 6eb3C
1q0zA Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin a (dcma) (see paper)
41% identity, 34% coverage: 29:116/262 of query aligns to 29:123/297 of 1q0zA
Sites not aligning to the query:
1q0rA Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin t (dcmat) (see paper)
41% identity, 34% coverage: 29:116/262 of query aligns to 29:123/297 of 1q0rA
Sites not aligning to the query:
6i8wB Crystal structure of a membrane phospholipase a, a novel bacterial virulence factor (see paper)
31% identity, 47% coverage: 3:124/262 of query aligns to 45:167/310 of 6i8wB
Sites not aligning to the query:
3b12A Crystal structure of the fluoroacetate dehalogenase d104 mutant from burkholderia sp. Fa1 in complex with fluoroacetate (see paper)
32% identity, 39% coverage: 18:120/262 of query aligns to 23:130/294 of 3b12A
Sites not aligning to the query:
Q1JU72 Fluoroacetate dehalogenase; EC 3.8.1.3 from Burkholderia sp. (see paper)
32% identity, 39% coverage: 18:120/262 of query aligns to 23:130/304 of Q1JU72
Sites not aligning to the query:
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
23% identity, 81% coverage: 47:259/262 of query aligns to 53:269/271 of 2d0dA
Sites not aligning to the query:
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
21% identity, 95% coverage: 10:259/262 of query aligns to 11:267/269 of 5h3hB
4nvrA 2.22 angstrom resolution crystal structure of a putative acyltransferase from salmonella enterica
30% identity, 43% coverage: 6:118/262 of query aligns to 23:138/302 of 4nvrA
Sites not aligning to the query:
5z7wB Crystal structure of striga hermonthica htl1 (shhtl1) (see paper)
25% identity, 81% coverage: 18:230/262 of query aligns to 16:236/271 of 5z7wB
Q10QA5 Strigolactone esterase D14; Protein DWARF 14; Protein DWARF 88; Protein HIGH-TILLERING DWARF 2; EC 3.1.-.- from Oryza sativa subsp. japonica (Rice) (see 4 papers)
27% identity, 74% coverage: 27:220/262 of query aligns to 76:274/318 of Q10QA5
Sites not aligning to the query:
6ap8A Crystal structure of rice d14 bound to 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
27% identity, 73% coverage: 27:216/262 of query aligns to 24:219/266 of 6ap8A
Sites not aligning to the query:
5dj5A Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24 (see paper)
27% identity, 73% coverage: 27:216/262 of query aligns to 24:219/266 of 5dj5A
Sites not aligning to the query:
5zhtA Crystal structure of osd14 in complex with covalently bound kk073 (see paper)
27% identity, 73% coverage: 27:216/262 of query aligns to 23:218/265 of 5zhtA
>H281DRAFT_02073 FitnessBrowser__Burk376:H281DRAFT_02073
MQVNINGIETRYVLSNEGGGPWLTFIHQLGGDLSVWDQLAGYFRDDYTVLRYDVRGHGQT
ELSKEPFSVGDLAGDLAALLDALGAPSTHLVGMSMGGMIAQQFALDHSSRVDSLTIADSV
AANPPEARATWDQRAASARRDGMAPLAAATLERWLTEDFRVAHPEAVEPIHEALTRTLPE
GYAMACEALREFDVRGKLGAIHCPTLVVAGRHDTGTRPAASQEIADAIEGAHFELLDAAH
LAPVEQSQRFAALLETFLERPV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory