Comparing H281DRAFT_02076 FitnessBrowser__Burk376:H281DRAFT_02076 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
62% identity, 100% coverage: 2:900/900 of query aligns to 341:1222/1227 of P13009
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
55% identity, 100% coverage: 1:900/900 of query aligns to 355:1260/1265 of Q99707
Sites not aligning to the query:
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
57% identity, 66% coverage: 311:900/900 of query aligns to 3:572/576 of 3ivaA
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
57% identity, 66% coverage: 311:900/900 of query aligns to 3:572/577 of 3bulA
3k13C Structure of the pterin-binding domain metr of 5- methyltetrahydrofolate-homocysteine methyltransferase from bacteroides thetaiotaomicron
67% identity, 32% coverage: 17:300/900 of query aligns to 4:286/287 of 3k13C
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
61% identity, 33% coverage: 1:296/900 of query aligns to 315:610/611 of 4cczA
1mskA Methionine synthase (activation domain) (see paper)
53% identity, 36% coverage: 574:900/900 of query aligns to 2:322/327 of 1mskA
6bdyA Crystal structure of the meth reactivation domain bound to sinefungin (see paper)
53% identity, 36% coverage: 574:900/900 of query aligns to 2:322/326 of 6bdyA
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
62% identity, 29% coverage: 311:568/900 of query aligns to 3:245/246 of 1bmtA
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
35% identity, 59% coverage: 15:543/900 of query aligns to 330:832/841 of 8g3hA
Sites not aligning to the query:
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 (see paper)
30% identity, 62% coverage: 316:870/900 of query aligns to 1:506/507 of 8sseA
5vooA Methionine synthase folate-binding domain with methyltetrahydrofolate from thermus thermophilus hb8 (see paper)
35% identity, 32% coverage: 15:300/900 of query aligns to 1:280/282 of 5vooA
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
32% identity, 21% coverage: 327:512/900 of query aligns to 12:188/215 of 7xcnP
Sites not aligning to the query:
2i2xB Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri (see paper)
33% identity, 18% coverage: 347:512/900 of query aligns to 65:216/258 of 2i2xB
Sites not aligning to the query:
Q46EH4 Methanol--corrinoid protein; Methanol:corrinoid methyltransferase 1 subunit of 27 kDa; MT1 subunit 27 kDa from Methanosarcina barkeri (strain Fusaro / DSM 804) (see paper)
33% identity, 18% coverage: 347:512/900 of query aligns to 65:216/258 of Q46EH4
Sites not aligning to the query:
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
27% identity, 27% coverage: 17:259/900 of query aligns to 315:538/560 of 3bofA
Sites not aligning to the query:
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
27% identity, 27% coverage: 17:259/900 of query aligns to 315:538/559 of 1q8jA
4jgiB 1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2 (see paper)
35% identity, 14% coverage: 362:483/900 of query aligns to 45:152/206 of 4jgiB
Sites not aligning to the query:
3ezxA Structure of methanosarcina barkeri monomethylamine corrinoid protein
32% identity, 22% coverage: 314:511/900 of query aligns to 2:185/212 of 3ezxA
Sites not aligning to the query:
2yckX Methyltransferase bound with tetrahydrofolate (see paper)
29% identity, 27% coverage: 16:258/900 of query aligns to 10:238/272 of 2yckX
>H281DRAFT_02076 FitnessBrowser__Burk376:H281DRAFT_02076
MRLAGLEPFNVTSGTLFINVGERTNVTGSKAFARMILNDQFDEAIAVARQQVENGAQVID
VNMDEAMLDSKAAMVRFMNLIASEPDIARVPIMIDSSKWEVIEAGLKCVQGKAIVNSISL
KEGEEAFRHHANLIRRYGAAAVVMAFDEQGQADTFERKTQICKRSYDFLVNEVGFPPEDI
IFDPNIFAIATGIEEHNNYAVDFINATRWIKENLPYAKVSGGVSNVSFSFRGNDPVREAI
HTVFLYHAIQAGMDMGIVNAGQLGVYADLDPELRERVEDVVLNRRPDGTDRLLEIADKFK
TGAAKKEENLEWRNQPVEKRLSHALVHGITNFIVEDTEEVRAKIAAAGGRPINVIEGPLM
DGMNIVGDLFGQGKMFLPQVVKSARVMKQAVAHLIPFIEEEKKQLAAAGGDVRAKGKIVI
ATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMVPCNDILAKAKVEGADIIGLSGLITPSL
EEMAYVASEMQRDDYFRVKKIPLLIGGATTSRVHTAVKIAPHYEGPVVYVPDASRSVSVA
SSLLSDEGATKYLDELKSDYERIRNQHANKKALPMVTLAEARANKTPIDWKGYQPVKPKF
IGRRVFKNFDLNELANYIDWGPFFQTWDLAGPYPAILNDEIVGESARRVFSDGKSMLARL
IQGRWLQANGVIALLPANTVNDDDIEIYTDESRTEVALTWRNLRQQSVRPVVDGVMRPNR
SLADFIAPKDSGVADYIGMFAVTAGLGVDVKEKQFEKDHDDYSAIMLKALADRFAEAFAE
ALHARVRRDLWGYANTENLSSDDLIAEKYRGIRPAPGYPACPDHLVKRDMFEVLQAGDIG
MSVTESLAMLPAASVSGFYLAHPDSTYFSVGKIGQDQLEDYAQRMSLSKADAERALAPLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory