SitesBLAST
Comparing H281DRAFT_02091 FitnessBrowser__Burk376:H281DRAFT_02091 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
56% identity, 99% coverage: 5:377/378 of query aligns to 8:378/378 of 4n5fA
- active site: L126 (= L123), T127 (= T124), G243 (= G242), E364 (= E363), R376 (= R375)
- binding dihydroflavine-adenine dinucleotide: L126 (= L123), T127 (= T124), G132 (= G129), S133 (= S130), F157 (= F156), T159 (= T158), T210 (= T209), Y363 (= Y362), T366 (= T365), E368 (≠ D367), M372 (≠ I371)
4m9aB Crystal structure of acyl-coa dehydrogenase from burkholderia thailandensis e264
54% identity, 99% coverage: 5:377/378 of query aligns to 6:376/376 of 4m9aB
- active site: L124 (= L123), T125 (= T124), G241 (= G242), E362 (= E363), R374 (= R375)
- binding dihydroflavine-adenine dinucleotide: F122 (= F121), T125 (= T124), G130 (= G129), S131 (= S130), F155 (= F156), T157 (= T158), T208 (= T209), Y361 (= Y362), T364 (= T365), E366 (≠ D367), M370 (≠ I371)
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
46% identity, 99% coverage: 3:377/378 of query aligns to 5:377/380 of 4l1fA
- active site: L125 (= L123), T126 (= T124), G242 (= G242), E363 (= E363), R375 (= R375)
- binding coenzyme a persulfide: T132 (≠ S130), H179 (≠ R179), F232 (≠ Y232), M236 (≠ L236), E237 (≠ S237), L239 (= L239), D240 (≠ E240), R243 (= R243), Y362 (= Y362), E363 (= E363), G364 (= G364), R375 (= R375)
- binding flavin-adenine dinucleotide: F123 (= F121), L125 (= L123), T126 (= T124), G131 (= G129), T132 (≠ S130), F156 (= F156), I157 (= I157), T158 (= T158), R268 (= R268), Q270 (≠ S270), F271 (= F271), I275 (≠ L275), F278 (≠ H278), L281 (≠ V281), Q336 (= Q336), I337 (= I337), G340 (= G340), I358 (≠ V358), Y362 (= Y362), T365 (= T365), Q367 (≠ D367)
- binding 1,3-propandiol: L5 (= L3), Q10 (≠ L8)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
46% identity, 98% coverage: 5:374/378 of query aligns to 6:373/378 of 5ol2F
- active site: L124 (= L123), T125 (= T124), G241 (= G242)
- binding calcium ion: E29 (≠ T28), E33 (= E32), R35 (≠ T34)
- binding coenzyme a persulfide: L238 (= L239), R242 (= R243), E362 (= E363), G363 (= G364)
- binding flavin-adenine dinucleotide: F122 (= F121), L124 (= L123), T125 (= T124), P127 (= P126), T131 (≠ S130), F155 (= F156), I156 (= I157), T157 (= T158), E198 (= E199), R267 (= R268), F270 (= F271), L274 (= L275), F277 (≠ H278), Q335 (= Q336), L336 (≠ I337), G338 (= G339), G339 (= G340), Y361 (= Y362), T364 (= T365), E366 (≠ D367)
Sites not aligning to the query:
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
47% identity, 98% coverage: 3:374/378 of query aligns to 34:403/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
47% identity, 98% coverage: 3:374/378 of query aligns to 7:376/384 of 1jqiA
- binding acetoacetyl-coenzyme a: L95 (≠ P91), F125 (= F121), S134 (= S130), F234 (≠ Y232), M238 (≠ L236), Q239 (≠ S237), L241 (= L239), D242 (≠ E240), R245 (= R243), Y364 (= Y362), E365 (= E363), G366 (= G364)
- binding flavin-adenine dinucleotide: F125 (= F121), L127 (= L123), S128 (≠ T124), G133 (= G129), S134 (= S130), W158 (≠ F156), T160 (= T158), R270 (= R268), F273 (= F271), L280 (≠ H278), Q338 (= Q336), I339 (= I337), G342 (= G340), I360 (≠ V358), T367 (= T365), E369 (≠ D367), I370 (= I368)
Sites not aligning to the query:
8sgsA Short-chain specific acyl-CoA dehydrogenase, mitochondrial (see paper)
47% identity, 98% coverage: 3:374/378 of query aligns to 4:373/381 of 8sgsA
- binding coenzyme a: S131 (= S130), A133 (= A132), N177 (≠ K178), F231 (≠ Y232), M235 (≠ L236), L238 (= L239), I312 (≠ L313), E362 (= E363), G363 (= G364)
- binding flavin-adenine dinucleotide: F122 (= F121), L124 (= L123), S125 (≠ T124), G130 (= G129), S131 (= S130), W155 (≠ F156), T157 (= T158), R267 (= R268), F270 (= F271), L274 (= L275), L277 (≠ H278), Q335 (= Q336), I336 (= I337), G338 (= G339), G339 (= G340), I357 (≠ V358), I360 (= I361), Y361 (= Y362), T364 (= T365), E366 (≠ D367)
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
47% identity, 98% coverage: 3:374/378 of query aligns to 7:376/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (≠ Y341), T347 (≠ S345), E348 (≠ D346)
- binding flavin-adenine dinucleotide: F125 (= F121), L127 (= L123), S128 (≠ T124), G133 (= G129), S134 (= S130), W158 (≠ F156), T160 (= T158), R270 (= R268), F273 (= F271), L280 (≠ H278), V282 (≠ A280), Q338 (= Q336), I339 (= I337), G342 (= G340), I360 (≠ V358), Y364 (= Y362), T367 (= T365), E369 (≠ D367), I370 (= I368), L373 (≠ I371)
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
47% identity, 98% coverage: 3:374/378 of query aligns to 10:379/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (= F121), L130 (= L123), S131 (≠ T124), G136 (= G129), S137 (= S130), W161 (≠ F156), T163 (= T158), T214 (= T209), R273 (= R268), F276 (= F271), L280 (= L275), L283 (≠ H278), V285 (≠ A280), Q341 (= Q336), I342 (= I337), G345 (= G340), I363 (≠ V358), Y367 (= Y362), T370 (= T365), E372 (≠ D367), L376 (≠ I371)
P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 3 papers)
47% identity, 98% coverage: 3:374/378 of query aligns to 34:403/412 of P16219
- G90 (= G59) to S: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908005
- E104 (= E73) natural variant: Missing (in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs387906308)
- 152:161 (vs. 121:130, 60% identical) binding in other chain
- R171 (≠ T140) to W: 69% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1800556
- WIT 185:187 (≠ FIT 156:158) binding in other chain
- A192 (≠ G163) to V: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940874
- G209 (= G180) to S: 86% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1799958
- R297 (= R268) binding
- Q308 (= Q279) binding in other chain
- R325 (= R296) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908006
- S353 (= S324) to L: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28941773
- QILGG 365:369 (≠ QIHGG 336:340) binding
- R380 (= R351) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940875
- TSE 394:396 (≠ TSD 365:367) binding in other chain
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
46% identity, 99% coverage: 5:377/378 of query aligns to 4:372/374 of 5lnxD
- active site: L122 (= L123), T123 (= T124), G239 (= G242), E358 (= E363), K370 (≠ R375)
- binding flavin-adenine dinucleotide: L122 (= L123), T123 (= T124), G128 (= G129), S129 (= S130), F153 (= F156), T155 (= T158), R265 (= R268), Q267 (≠ S270), F268 (= F271), I272 (≠ L275), N275 (≠ H278), I278 (≠ V281), Q331 (= Q336), I332 (= I337), G335 (= G340), Y357 (= Y362), T360 (= T365), E362 (≠ D367)
2vigB Crystal structure of human short-chain acyl coa dehydrogenase
46% identity, 98% coverage: 3:374/378 of query aligns to 1:363/371 of 2vigB
- active site: L121 (= L123), S122 (≠ T124), G231 (= G242), E352 (= E363)
- binding coenzyme a persulfide: S128 (= S130), F221 (≠ Y232), M225 (≠ L236), Q226 (≠ S237), L228 (= L239), D229 (≠ E240), R232 (= R243), E352 (= E363), G353 (= G364), I357 (= I368)
- binding flavin-adenine dinucleotide: L121 (= L123), S122 (≠ T124), G127 (= G129), S128 (= S130), W152 (≠ F156), T154 (= T158), R257 (= R268), F260 (= F271), L264 (= L275), L267 (≠ H278), Q325 (= Q336), I326 (= I337), G329 (= G340), I347 (≠ V358), Y351 (= Y362), T354 (= T365), E356 (≠ D367)
Sites not aligning to the query:
2dvlA Crystal structure of project tt0160 from thermus thermophilus hb8
49% identity, 99% coverage: 3:377/378 of query aligns to 1:368/370 of 2dvlA
- active site: L121 (= L123), T122 (= T124), G233 (= G242), E354 (= E363), R366 (= R375)
- binding flavin-adenine dinucleotide: L121 (= L123), T122 (= T124), G127 (= G129), S128 (= S130), W152 (≠ F156), I153 (= I157), T154 (= T158), T356 (= T365), E358 (≠ D367)
1bucA Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
44% identity, 93% coverage: 17:369/378 of query aligns to 19:373/383 of 1bucA
- active site: L128 (= L123), T129 (= T124), G246 (= G242), E367 (= E363)
- binding acetoacetyl-coenzyme a: L96 (≠ P91), F126 (= F121), G134 (= G129), T135 (≠ S130), T162 (= T158), N182 (≠ K178), H183 (≠ R179), F236 (≠ Y232), M240 (≠ L236), M241 (≠ S237), L243 (= L239), D244 (≠ E240), T317 (≠ L313), Y366 (= Y362), E367 (= E363), G368 (= G364)
- binding flavin-adenine dinucleotide: F126 (= F121), L128 (= L123), T129 (= T124), G134 (= G129), T135 (≠ S130), F160 (= F156), T162 (= T158), Y366 (= Y362), T369 (= T365), E371 (≠ D367)
Sites not aligning to the query:
Q06319 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; BCAD; SCAD; EC 1.3.8.1 from Megasphaera elsdenii (see paper)
44% identity, 93% coverage: 17:369/378 of query aligns to 19:373/383 of Q06319
- E367 (= E363) active site, Proton acceptor; mutation to Q: Loss of activity.
2d29A Structural study on project id tt0172 from thermus thermophilus hb8
50% identity, 96% coverage: 14:377/378 of query aligns to 17:382/386 of 2d29A
- active site: L126 (= L123), T127 (= T124), G247 (= G242), E368 (= E363), R380 (= R375)
- binding flavin-adenine dinucleotide: L126 (= L123), T127 (= T124), G132 (= G129), S133 (= S130), F157 (= F156), I158 (= I157), T159 (= T158), L363 (≠ V358), T370 (= T365), E372 (≠ D367)
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
42% identity, 99% coverage: 1:374/378 of query aligns to 1:373/379 of 6fahD
- active site: L124 (= L123), T125 (= T124), G241 (= G242)
- binding flavin-adenine dinucleotide: F122 (= F121), L124 (= L123), T125 (= T124), R152 (≠ V153), F155 (= F156), T157 (= T158), E198 (= E199), R267 (= R268), Q269 (≠ S270), F270 (= F271), I274 (≠ L275), F277 (≠ H278), Q335 (= Q336), I336 (= I337), G339 (= G340), Y361 (= Y362), T364 (= T365), Q366 (≠ D367)
Sites not aligning to the query:
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
41% identity, 99% coverage: 3:377/378 of query aligns to 5:376/379 of 1ukwB
- active site: L124 (= L123), S125 (≠ T124), T241 (≠ G242), E362 (= E363), R374 (= R375)
- binding cobalt (ii) ion: D145 (= D146), H146 (≠ A147)
- binding flavin-adenine dinucleotide: F122 (= F121), L124 (= L123), S125 (≠ T124), G130 (= G129), S131 (= S130), W155 (≠ F156), S157 (≠ T158), K200 (= K201), L357 (≠ V358), Y361 (= Y362), E362 (= E363), T364 (= T365), E366 (≠ D367), L370 (≠ I371)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
41% identity, 99% coverage: 3:377/378 of query aligns to 5:376/379 of 1ukwA
- active site: L124 (= L123), S125 (≠ T124), T241 (≠ G242), E362 (= E363), R374 (= R375)
- binding flavin-adenine dinucleotide: F122 (= F121), L124 (= L123), S125 (≠ T124), G130 (= G129), S131 (= S130), W155 (≠ F156), S157 (≠ T158), L357 (≠ V358), Y361 (= Y362), E362 (= E363), T364 (= T365), E366 (≠ D367), L370 (≠ I371)
3pfdC Crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr (see paper)
42% identity, 98% coverage: 7:377/378 of query aligns to 1:367/369 of 3pfdC
- active site: L116 (= L123), S117 (≠ T124), T233 (≠ G242), E353 (= E363), R365 (= R375)
- binding dihydroflavine-adenine dinucleotide: Y114 (≠ F121), L116 (= L123), S117 (≠ T124), G122 (= G129), S123 (= S130), W147 (≠ F156), I148 (= I157), T149 (= T158), R259 (= R268), F262 (= F271), V266 (≠ L275), N269 (≠ H278), Q326 (= Q336), L327 (≠ I337), G330 (= G340), I348 (≠ V358), Y352 (= Y362), T355 (= T365), Q357 (≠ D367)
Query Sequence
>H281DRAFT_02091 FitnessBrowser__Burk376:H281DRAFT_02091
MVLDQDHLMVRDALRTFVREAVTPYAATWDRERTFPKDVHRQLAELGAYGVLVPETYGGA
GMDALALALILEEIAAGDGGTSTAISVNNCPVCSILLTYGNDAQKREWLTPLARGEMLGA
FCLTEPQAGSDASALRTTATRDKDGDAYVLNGVKQFITSGKNGDVAIVMAVTDKAAGKRG
ISAFIVPTDSKGYVVARVEDKLGQHSSDTAQIIFEDCRVPAANLIGAEGEGYRIALSGLE
GGRIGIAAQSVGMARAAYEAALTYAKERESFGQPLFSHQAVQFRLADMATQLEAARQLIW
HAASLKDAGQPCLTEAAMAKLFASEAAERICSAALQIHGGYGYLSDFPVERIYRDVRVCQ
IYEGTSDIQKILIARGLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory