Comparing H281DRAFT_02161 FitnessBrowser__Burk376:H281DRAFT_02161 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
37% identity, 90% coverage: 28:371/381 of query aligns to 2:338/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
37% identity, 90% coverage: 28:371/381 of query aligns to 2:338/348 of 3ip7A
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
37% identity, 90% coverage: 28:371/381 of query aligns to 2:338/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
37% identity, 90% coverage: 28:371/381 of query aligns to 2:338/348 of 3ip5A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
37% identity, 90% coverage: 28:371/381 of query aligns to 2:338/348 of 3ipcA
1uskA L-leucine-binding protein with leucine bound (see paper)
34% identity, 89% coverage: 31:370/381 of query aligns to 3:338/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
34% identity, 89% coverage: 31:370/381 of query aligns to 3:338/345 of 1usiA
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
32% identity, 90% coverage: 31:372/381 of query aligns to 3:341/345 of 4n0qB
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
33% identity, 89% coverage: 31:370/381 of query aligns to 3:336/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
33% identity, 89% coverage: 31:370/381 of query aligns to 3:336/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
33% identity, 89% coverage: 31:370/381 of query aligns to 3:336/344 of 1z16A
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
30% identity, 85% coverage: 52:376/381 of query aligns to 20:336/336 of 4mlcA
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
30% identity, 85% coverage: 52:376/381 of query aligns to 20:335/335 of 4q6bA
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
31% identity, 88% coverage: 30:363/381 of query aligns to 1:330/350 of 3td9A
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
30% identity, 85% coverage: 31:354/381 of query aligns to 3:322/348 of 4gnrA
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
28% identity, 93% coverage: 27:379/381 of query aligns to 1:375/376 of 4q6wA
4eygB Crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with vanillic acid (see paper)
28% identity, 85% coverage: 32:355/381 of query aligns to 5:326/364 of 4eygB
4rdcA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with proline
25% identity, 77% coverage: 31:324/381 of query aligns to 3:295/364 of 4rdcA
Sites not aligning to the query:
4qymA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with methionine
25% identity, 77% coverage: 31:324/381 of query aligns to 3:295/364 of 4qymA
Sites not aligning to the query:
4otzA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with cystein
25% identity, 77% coverage: 31:324/381 of query aligns to 3:295/364 of 4otzA
Sites not aligning to the query:
>H281DRAFT_02161 FitnessBrowser__Burk376:H281DRAFT_02161
MNIKIQKLLPISAAAMLFATLATSAAADTVVKIGHVAPLTGGIAHLGKDNENGARLAVEE
INAKGLTIGGQKITLQLDAQDDAADPRTATQVAQKLVDDKVVAVVGHLNSGTSIPASKIY
SDAGIVQISPSATNPAYTQQGFKTTYRVVATDAQQGPALANYAAKGLKVKSVAIVDDSTA
YGQGLANEFEKTAKSLGLNVMSHDATNDKAVDFRAILTKIKGENPDAIMYGGMDATGGPF
AKQAKQLGLRAKVLAGDGVCTDKLSDLAGDATDNIVCSEAGMALEKMEGGPAFQAKYLKR
FGQPIQIYAPFTYDAVYIIVDAMKRAGSTDPAKILAAMPNTDYKGVIGQTTFDSKGDLKH
GVISLYNYKSGKKTLLDVVKM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory