Comparing H281DRAFT_02173 FitnessBrowser__Burk376:H281DRAFT_02173 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
45% identity, 83% coverage: 55:339/343 of query aligns to 3:287/305 of 6hbdA
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
45% identity, 83% coverage: 55:339/343 of query aligns to 2:286/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
45% identity, 83% coverage: 55:339/343 of query aligns to 2:286/304 of 6hbmA
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
40% identity, 82% coverage: 57:336/343 of query aligns to 3:274/274 of 2ioyA
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
43% identity, 76% coverage: 57:318/343 of query aligns to 3:263/302 of 5ocpA
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
43% identity, 78% coverage: 54:320/343 of query aligns to 23:290/318 of P39325
Sites not aligning to the query:
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
43% identity, 78% coverage: 54:320/343 of query aligns to 1:268/296 of 2vk2A
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
36% identity, 83% coverage: 55:337/343 of query aligns to 9:281/284 of 7e7mC
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
36% identity, 74% coverage: 65:319/343 of query aligns to 12:257/271 of 1dbpA
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
35% identity, 76% coverage: 65:325/343 of query aligns to 13:267/270 of 4zjpA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
33% identity, 81% coverage: 65:342/343 of query aligns to 12:290/292 of 2fn8A
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
33% identity, 70% coverage: 55:295/343 of query aligns to 2:237/301 of 2x7xA
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
30% identity, 73% coverage: 49:300/343 of query aligns to 3:251/296 of 4irxA
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 69% coverage: 86:323/343 of query aligns to 65:298/349 of A0QYB5
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
32% identity, 69% coverage: 86:323/343 of query aligns to 33:266/315 of 4rsmA
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 69% coverage: 86:321/343 of query aligns to 65:293/349 of A0QYB3
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
32% identity, 69% coverage: 86:321/343 of query aligns to 32:260/315 of 4rs3A
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
32% identity, 69% coverage: 86:321/343 of query aligns to 32:260/314 of 5hkoA
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
30% identity, 71% coverage: 77:319/343 of query aligns to 29:265/287 of 4yo7A
Sites not aligning to the query:
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
33% identity, 75% coverage: 65:320/343 of query aligns to 13:261/287 of 5ibqA
>H281DRAFT_02173 FitnessBrowser__Burk376:H281DRAFT_02173
MALLNKEARRNARTQKIRPLAGSLLALAVGLGAGLGAIAAHAEDALPKLPGKTPLKVGFA
QTESNNPWRLAETRSFKEVAAKCGWQLVMTDANGSNSKQVSDIQSMIAQHVDLLVFPPRE
EKPLAPVVLQAKKAGIPVILVDRNVDQSVAVAGRDYITFIGSDFIDQGHRAADWLVKATG
GKAKIIELEGTTGASAANDRKKGFDEIIAKNPGMTIIASQSGDFARDKGRQVMETLLQAH
PDVTAVYAHNDEMALGAIAAIKAAGKQPGKDIQIVTIDGTKGGLDAIAAGELGASVQSSP
FFGPLACDVAQRYAKGEKIPTWVKVSDRFYDKSNVQQSMQYGY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory