Comparing H281DRAFT_02174 FitnessBrowser__Burk376:H281DRAFT_02174 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
43% identity, 90% coverage: 24:516/550 of query aligns to 4:490/501 of P04983
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
33% identity, 38% coverage: 295:502/550 of query aligns to 18:217/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 41% coverage: 295:522/550 of query aligns to 18:237/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 41% coverage: 295:522/550 of query aligns to 18:237/238 of 6s8gA
Sites not aligning to the query:
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
35% identity, 38% coverage: 295:502/550 of query aligns to 18:217/233 of 6b8bA
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
35% identity, 38% coverage: 295:502/550 of query aligns to 18:217/234 of 6b89A
Sites not aligning to the query:
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
35% identity, 38% coverage: 295:502/550 of query aligns to 18:217/234 of 4p31A
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
35% identity, 38% coverage: 295:502/550 of query aligns to 18:217/235 of 6mhzA
Sites not aligning to the query:
6mbnA Lptb e163q in complex with atp (see paper)
33% identity, 41% coverage: 295:522/550 of query aligns to 19:238/241 of 6mbnA
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 40% coverage: 24:241/550 of query aligns to 4:231/253 of 1g9xB
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 38% coverage: 37:247/550 of query aligns to 18:228/343 of P30750
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 41% coverage: 24:247/550 of query aligns to 2:223/241 of 4u00A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 40% coverage: 24:241/550 of query aligns to 4:231/254 of 1g6hA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 38% coverage: 37:247/550 of query aligns to 19:229/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 38% coverage: 37:247/550 of query aligns to 19:229/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 38% coverage: 37:247/550 of query aligns to 19:229/344 of 3tuiC
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 41% coverage: 24:247/550 of query aligns to 1:223/240 of 4ymuJ
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
30% identity, 39% coverage: 35:247/550 of query aligns to 37:250/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
30% identity, 39% coverage: 35:247/550 of query aligns to 37:250/382 of 7aheC
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 39% coverage: 24:239/550 of query aligns to 4:222/648 of P75831
>H281DRAFT_02174 FitnessBrowser__Burk376:H281DRAFT_02174
VTQSGMHTPHSPQPSQSPATRPLLLEMQDIGISFGGVPALRGANLSVAAGEVHALIGQNG
AGKSTMIKILTGAYRRGSGSVRFEGREVDFRTPKQAREAGISTIYQEINLVPFRSVAENI
FLGREPRRFGLIDWRTVQHRAAALLDSFGLHIDVKKPVGRYSTAIQQMVALARAVSSDAK
MVIMDESTSSLDEREVELLFTVVRKLRDDGRAVIFVSHRLDELYALCDRVTVMRDGQTVA
QSTMAEMDKLQLVTTMLGRTLAAVVHDDPAAREANLARRGKQAIAARDLGAHPKVSDVSL
EVHAGEAVGLAGLLGSGRTETMRLMFGADPLERGSVSIDGATVTLKSPQDAIARGLAYLT
EDRKAEGIVPELSVRDNLTLVCLRTLTRNGIVDVKKQQAIVDRFIASLGIKLRSADQPIR
ELSGGNQQKVLLARWLAAEPSLLLLDEPTRGIDVGAKADVAKIVRELRDAGLAVLMSASE
LEELTAVSDRAVVIRDGRTVAELNGAEMSESAIMDAIAYGGDSSSQLAEAAQTASAAHIE
DALEGDRHGV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory