SitesBLAST
Comparing H281DRAFT_02221 FitnessBrowser__Burk376:H281DRAFT_02221 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3h0mA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
48% identity, 99% coverage: 1:492/495 of query aligns to 2:476/478 of 3h0mA
- active site: K72 (= K75), S147 (= S150), S148 (= S151), S166 (≠ T169), T168 (= T171), G169 (= G172), G170 (= G173), S171 (= S174), Q174 (= Q177)
- binding glutamine: M122 (= M125), G123 (= G126), D167 (= D170), T168 (= T171), G169 (= G172), G170 (= G173), S171 (= S174), F199 (= F202), Y302 (= Y314), R351 (= R363), D418 (= D430)
3h0lA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
48% identity, 99% coverage: 1:492/495 of query aligns to 2:476/478 of 3h0lA
- active site: K72 (= K75), S147 (= S150), S148 (= S151), S166 (≠ T169), T168 (= T171), G169 (= G172), G170 (= G173), S171 (= S174), Q174 (= Q177)
- binding asparagine: G123 (= G126), S147 (= S150), G169 (= G172), G170 (= G173), S171 (= S174), Y302 (= Y314), R351 (= R363), D418 (= D430)
2f2aA Structure of tRNA-dependent amidotransferase gatcab complexed with gln (see paper)
50% identity, 92% coverage: 36:488/495 of query aligns to 39:479/485 of 2f2aA
- active site: K79 (= K75), S154 (= S150), S155 (= S151), S173 (≠ T169), T175 (= T171), G176 (= G172), G177 (= G173), S178 (= S174), Q181 (= Q177)
- binding glutamine: G130 (= G126), S154 (= S150), D174 (= D170), T175 (= T171), G176 (= G172), S178 (= S174), F206 (= F202), Y309 (= Y314), Y310 (= Y315), R358 (= R363), D425 (= D430)
2dqnA Structure of tRNA-dependent amidotransferase gatcab complexed with asn (see paper)
50% identity, 92% coverage: 36:488/495 of query aligns to 39:479/485 of 2dqnA
- active site: K79 (= K75), S154 (= S150), S155 (= S151), S173 (≠ T169), T175 (= T171), G176 (= G172), G177 (= G173), S178 (= S174), Q181 (= Q177)
- binding asparagine: M129 (= M125), G130 (= G126), T175 (= T171), G176 (= G172), S178 (= S174), Y309 (= Y314), Y310 (= Y315), R358 (= R363), D425 (= D430)
3kfuE Crystal structure of the transamidosome (see paper)
47% identity, 98% coverage: 8:494/495 of query aligns to 4:467/468 of 3kfuE
4n0iA Crystal structure of s. Cerevisiae mitochondrial gatfab in complex with glutamine (see paper)
35% identity, 84% coverage: 67:481/495 of query aligns to 30:449/450 of 4n0iA
- active site: K38 (= K75), S116 (= S150), S117 (= S151), T135 (= T169), T137 (= T171), G138 (= G172), G139 (= G173), S140 (= S174), L143 (≠ Q177)
- binding glutamine: G89 (= G126), T137 (= T171), G138 (= G172), S140 (= S174), Y168 (≠ F202), Y271 (= Y314), Y272 (= Y315), R320 (= R363), D404 (= D430)
1m21A Crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin (see paper)
33% identity, 98% coverage: 3:489/495 of query aligns to 5:483/487 of 1m21A
- active site: K81 (= K75), S160 (= S150), S161 (= S151), T179 (= T169), T181 (= T171), D182 (≠ G172), G183 (= G173), S184 (= S174), C187 (≠ Q177)
- binding : A129 (= A124), N130 (≠ M125), F131 (≠ G126), C158 (≠ G148), G159 (= G149), S160 (= S150), S184 (= S174), C187 (≠ Q177), I212 (≠ F202), R318 (≠ Y315), L321 (≠ A318), L365 (≠ I364), F426 (vs. gap)
Q84DC4 Mandelamide hydrolase; EC 3.5.1.86 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
32% identity, 97% coverage: 3:482/495 of query aligns to 27:487/507 of Q84DC4
- T31 (= T7) mutation to I: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with N-437.
- K100 (= K75) mutation to A: Abolishes activity on mandelamide.
- S180 (= S150) mutation to A: Significantly decreases activity on mandelamide.
- S181 (= S151) mutation to A: Significantly decreases activity on mandelamide.
- G202 (= G172) mutation to A: Increase in KM values for aromatic substrates, but not aliphatic substrates. Active against lactamide but not against mandelamide; when associated with H-207 and E-382.; mutation to V: Increase in KM values for aromatic substrates, but not aliphatic substrates.
- S204 (= S174) mutation to A: Abolishes activity on mandelamide.
- Q207 (= Q177) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with E-382. Active against lactamide but not against mandelamide; when associated with A-202 and E-382. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with S-316 and N-437.
- S316 (= S310) mutation to N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-437.
- Q382 (≠ R362) mutation to H: Increases activity on lactamide, does not affect activity on mandelamide; when associated with H-207. Active against lactamide but not against mandelamide; when associated with A-202 and H-207.
- I437 (≠ L434) mutation to N: More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with I-31. More active on the (S)-enantiomers of mandelamide and lactamide than the (R)-enantiomers; when associated with H-207 and N-316.
6c6gA An unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. Inhibitor bound complex. (see paper)
33% identity, 96% coverage: 7:482/495 of query aligns to 4:448/457 of 6c6gA
3a1iA Crystal structure of rhodococcus sp. N-771 amidase complexed with benzamide (see paper)
32% identity, 85% coverage: 65:483/495 of query aligns to 85:498/508 of 3a1iA
- active site: K95 (= K75), S170 (= S150), S171 (= S151), G189 (≠ T169), Q191 (≠ T171), G192 (= G172), G193 (= G173), A194 (≠ S174), I197 (≠ Q177)
- binding benzamide: F145 (≠ M125), S146 (≠ G126), G147 (≠ S127), Q191 (≠ T171), G192 (= G172), G193 (= G173), A194 (≠ S174), W327 (≠ Y314)
6diiH Structure of arabidopsis fatty acid amide hydrolase in complex with methyl linolenyl fluorophosphonate (see paper)
28% identity, 91% coverage: 40:490/495 of query aligns to 169:596/616 of 6diiH
- binding methyl-9Z,12Z,15Z-octadecatrienylphosphonofluoridate: G255 (≠ A124), T258 (≠ S127), S281 (= S150), G302 (≠ T171), G303 (= G172), S305 (= S174), S472 (≠ A368), I532 (≠ V424), M539 (vs. gap)
Sites not aligning to the query:
Q7XJJ7 Fatty acid amide hydrolase; AtFAAH; N-acylethanolamine amidohydrolase; EC 3.5.1.99 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 91% coverage: 40:490/495 of query aligns to 169:596/607 of Q7XJJ7
- K205 (= K75) mutation to A: Loss of activity.
- SS 281:282 (= SS 150:151) mutation to AA: Loss of activity.
- GGGS 302:305 (≠ TGGS 171:174) binding
- S305 (= S174) mutation to A: Loss of activity.
- R307 (= R176) mutation to A: Loss of activity.
- S360 (≠ F229) mutation to A: No effect.
5h6sC Crystal structure of hydrazidase s179a mutant complexed with a substrate (see paper)
27% identity, 96% coverage: 7:483/495 of query aligns to 8:445/457 of 5h6sC
- active site: K77 (= K75), S152 (= S150), S153 (= S151), L173 (≠ T171), G174 (= G172), G175 (= G173), S176 (= S174)
- binding 4-oxidanylbenzohydrazide: C126 (≠ A124), R128 (≠ G126), W129 (≠ S127), S152 (= S150), L173 (≠ T171), G174 (= G172), S176 (= S174), W306 (≠ Y314), F338 (≠ Y348)
4gysB Granulibacter bethesdensis allophanate hydrolase co-crystallized with malonate (see paper)
32% identity, 88% coverage: 48:483/495 of query aligns to 47:439/461 of 4gysB
- active site: K72 (= K75), S146 (= S150), S147 (= S151), T165 (= T169), T167 (= T171), A168 (≠ G172), G169 (= G173), S170 (= S174), V173 (≠ Q177)
- binding malonate ion: A120 (= A124), G122 (= G126), S146 (= S150), T167 (= T171), A168 (≠ G172), S170 (= S174), S193 (≠ Y197), G194 (= G198), V195 (≠ M199), R200 (≠ S204), Y297 (≠ F329), R305 (= R337)
4yjiA The crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family (see paper)
27% identity, 100% coverage: 1:494/495 of query aligns to 3:487/490 of 4yjiA
- active site: K79 (= K75), S158 (= S150), S159 (= S151), G179 (≠ T171), G180 (= G172), G181 (= G173), A182 (≠ S174)
- binding n-(4-hydroxyphenyl)acetamide (tylenol): L81 (≠ V77), G132 (≠ A124), S158 (= S150), G179 (≠ T171), G180 (= G172), A182 (≠ S174)
6te4A Structural insights into pseudomonas aeruginosa type six secretion system exported effector 8: tse8 in complex with a peptide (see paper)
35% identity, 51% coverage: 1:252/495 of query aligns to 2:253/564 of 6te4A
Sites not aligning to the query:
Q9FR37 Amidase 1; AtAMI1; Translocon at the outer membrane of chloroplasts 64-I; AtTOC64-I; EC 3.5.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
44% identity, 32% coverage: 67:222/495 of query aligns to 28:182/425 of Q9FR37
- K36 (= K75) active site, Charge relay system; mutation to A: Loss of catalytic activity.; mutation to R: Reduces catalytic activity 10-fold.
- S113 (= S150) active site, Charge relay system; mutation S->A,T: Loss of catalytic activity.
- S114 (= S151) mutation to A: Loss of catalytic activity.; mutation to T: Reduces catalytic activity 400-fold.
- D133 (= D170) mutation to A: Loss of catalytic activity.; mutation to E: Reduces catalytic activity 600-fold.
- S137 (= S174) active site, Acyl-ester intermediate; mutation to A: Reduces catalytic activity 170-fold.; mutation to T: Loss of catalytic activity.
- C145 (≠ S182) mutation C->A,S: Reduces catalytic activity 10-fold.
Sites not aligning to the query:
- 214 S→T: Slightly reduces catalytic activity.
Q936X2 Allophanate hydrolase; EC 3.5.1.54 from Pseudomonas sp. (strain ADP) (see paper)
28% identity, 85% coverage: 62:481/495 of query aligns to 78:460/605 of Q936X2
- K91 (= K75) mutation to A: Loss of activity.
- S165 (= S150) mutation to A: Loss of activity.
- S189 (= S174) mutation to A: Loss of activity.
3a2qA Structure of 6-aminohexanoate cyclic dimer hydrolase complexed with substrate (see paper)
35% identity, 44% coverage: 17:234/495 of query aligns to 18:234/482 of 3a2qA
- active site: K69 (= K75), S147 (= S150), S148 (= S151), N166 (≠ T169), A168 (≠ T171), A169 (≠ G172), G170 (= G173), A171 (≠ S174), I174 (≠ Q177)
- binding 6-aminohexanoic acid: G121 (≠ A124), G121 (≠ A124), N122 (≠ M125), S147 (= S150), A168 (≠ T171), A168 (≠ T171), A169 (≠ G172), A171 (≠ S174)
Sites not aligning to the query:
Q9TUI8 Fatty-acid amide hydrolase 1; Anandamide amidase; Anandamide amidohydrolase 1; Fatty acid ester hydrolase; Oleamide hydrolase 1; EC 3.5.1.99; EC 3.1.1.- from Sus scrofa (Pig) (see paper)
40% identity, 32% coverage: 58:214/495 of query aligns to 125:285/579 of Q9TUI8
- S217 (= S150) mutation to A: Loss of activity.
- S218 (= S151) mutation to A: Lowers activity by at least 98%.
- D237 (= D170) mutation D->E,N: Loss of activity.
- S241 (= S174) mutation to A: Loss of activity.
- C249 (≠ S182) mutation to A: Loss of activity.
Query Sequence
>H281DRAFT_02221 FitnessBrowser__Burk376:H281DRAFT_02221
MHEKSLTELRAALAAKECSAVELAQLYLKRIDAANSLNAFIQVDADLTLAQAKAADALLH
AGHGGPLTGLPIAHKDVFVTKGWRSTAGSKMLSNYESPFDATVVERLQKAGMVCVGKTNM
DEFAMGSSNENSYFGPVQNPWDRQAVPGGSSGGSAAAVAARLAPAATGTDTGGSIRQPAS
FSGITGIKPTYGRVSRYGMIAFASSLDQGGPMAQSAADCATLLNAMAGFDERDSTSLVRD
DEDYTRYLGQPWKQDGAGKPLAGLRIGLPKEYFGAGLADDVRASIDAALKEYEALGATLV
EVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAAEYRDLLDMYKKSRAEGFGPEV
KRRIMVGAYVLSHGYYDAYYLQAQKIRRIIAQDFQEAFKQCDVIMGPVAPSVAWDLGAKG
DDPVQMYLADVYTLSVSLAGLPGMSVPCGFGAGANAQRPVGLQIIGNYFNEARMLQVADA
FQRATDWHRKAPAGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory