Comparing H281DRAFT_02331 FitnessBrowser__Burk376:H281DRAFT_02331 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
46% identity, 95% coverage: 28:520/520 of query aligns to 2:494/501 of P04983
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 39% coverage: 39:242/520 of query aligns to 10:212/240 of 4ymuJ
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 42% coverage: 24:243/520 of query aligns to 11:225/378 of P69874
Sites not aligning to the query:
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
32% identity, 39% coverage: 43:245/520 of query aligns to 20:221/615 of 5lilA
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
32% identity, 39% coverage: 43:245/520 of query aligns to 20:221/592 of 5lj7A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 41% coverage: 29:242/520 of query aligns to 3:219/648 of P75831
7arlD Lolcde in complex with lipoprotein and adp (see paper)
32% identity, 41% coverage: 31:243/520 of query aligns to 3:219/222 of 7arlD
7mdyC Lolcde nucleotide-bound
32% identity, 41% coverage: 31:243/520 of query aligns to 3:219/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 41% coverage: 31:243/520 of query aligns to 6:222/233 of P75957
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 42% coverage: 31:246/520 of query aligns to 2:221/343 of P30750
Sites not aligning to the query:
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
31% identity, 41% coverage: 31:243/520 of query aligns to 5:221/229 of 7v8iD
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 41% coverage: 31:245/520 of query aligns to 5:229/254 of 1g6hA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 42% coverage: 31:246/520 of query aligns to 3:222/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 42% coverage: 31:246/520 of query aligns to 3:222/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 42% coverage: 31:246/520 of query aligns to 3:222/344 of 3tuiC
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 42% coverage: 29:245/520 of query aligns to 1:214/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 40% coverage: 40:249/520 of query aligns to 13:227/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 40% coverage: 40:249/520 of query aligns to 13:227/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 40% coverage: 40:249/520 of query aligns to 13:227/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 40% coverage: 40:249/520 of query aligns to 13:227/242 of 2oljA
>H281DRAFT_02331 FitnessBrowser__Burk376:H281DRAFT_02331
MTSSHTATSLGGADAPLQTPSPVPASTEPYLQLDGITVRFPGVLALDQVSLEVRRGEVHG
LMGENGAGKSTLLKVLSGVNQPAAGTLSLDGVEQQFTTTKAAIAAGVAIIYQELHLVPEL
TVAENLMLGALPNRFGVLDEKALVARAVRELERLGEKIDPSQQVKNLSIGQRQMIEIGKA
LMRDARVIAFDEPTSSLSSRETTQLFRIIRALRAEGRAIIYVTHRMDEVYELCDRVTVFR
DGRRIDTFDAGAGLDRDRLISCMVGRSIADVYGYRTRDVGDVQLDVKGLMGPGLREPATF
SARKGEIVGFFGLVGAGRSELMKLIYGAVKPTAGDITLKGKQVRFATPRDAVRAGVALCP
EDRKQEGIVSIASVSDNLNISCRRHFSRFNVLNGRKEAQTAKEFIGKLAIKTRNGETPIG
TLSGGNQQKVILSRWLAEDIDVFLMDEPTRGIDVGARSEIYGLLYGLADAGRTVIVVSSD
LAEVIGVTDRVIVMKEGRLVGDLPKAQATPDALIKLALPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory