Comparing H281DRAFT_02332 FitnessBrowser__Burk376:H281DRAFT_02332 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
4kzkA The structure of the periplasmic l-arabinose binding protein from burkholderia thailandensis
49% identity, 90% coverage: 34:334/334 of query aligns to 1:301/301 of 4kzkA
5abpA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
46% identity, 90% coverage: 34:334/334 of query aligns to 2:302/305 of 5abpA
1abfA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
46% identity, 90% coverage: 34:334/334 of query aligns to 2:302/305 of 1abfA
1abeA Novel stereospecificity of the l-arabinose-binding protein (see paper)
46% identity, 90% coverage: 34:334/334 of query aligns to 2:302/305 of 1abeA
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
25% identity, 61% coverage: 70:273/334 of query aligns to 40:231/288 of 4rxmB
Sites not aligning to the query:
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
25% identity, 61% coverage: 70:273/334 of query aligns to 42:233/291 of 4rxmA
Sites not aligning to the query:
>H281DRAFT_02332 FitnessBrowser__Burk376:H281DRAFT_02332
MTSKLRRLTLTAIAAAAIAAPFAAQLSAHADQPLKVGFLVKMPEQAWFINEQKAATALGQ
KDGFSVVNIGTPDGEKVLSAIDNLGAQGAKGFVICAPDVRLGPAIQARAKRYNMKFVTVD
DQLVDSSGKPLANVPHLGMSAFKIGNQVGQAISDEMKRRGWKPEEVGALRITNYELPTAK
LRTDGATETLLAGGFKKENIFDAPQKTTDDEGGFNASSPVLAKHPNIKKWVIFALNEESV
LGGVRATEQLHIPAADVIGVGINGAGEAFAEFQKKEPTGFYGTIAVSSTMHGKESTENLV
EWIKDGKQPPADTQTTGKLMVRGNWQDVRKELGI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory