Comparing H281DRAFT_02405 H281DRAFT_02405 amino acid/amide ABC transporter substrate-binding protein, HAAT family to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
40% identity, 91% coverage: 30:377/382 of query aligns to 2:347/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
40% identity, 91% coverage: 30:377/382 of query aligns to 2:347/348 of 3ip7A
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
40% identity, 91% coverage: 30:377/382 of query aligns to 2:347/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
40% identity, 91% coverage: 30:377/382 of query aligns to 2:347/348 of 3ip5A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
40% identity, 91% coverage: 30:377/382 of query aligns to 2:347/348 of 3ipcA
1uskA L-leucine-binding protein with leucine bound (see paper)
33% identity, 87% coverage: 29:359/382 of query aligns to 1:327/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
33% identity, 87% coverage: 29:359/382 of query aligns to 1:327/345 of 1usiA
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
31% identity, 91% coverage: 30:376/382 of query aligns to 2:345/345 of 4n0qB
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
32% identity, 87% coverage: 29:359/382 of query aligns to 1:325/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
32% identity, 87% coverage: 29:359/382 of query aligns to 1:325/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
32% identity, 87% coverage: 29:359/382 of query aligns to 1:325/344 of 1z16A
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
28% identity, 91% coverage: 29:376/382 of query aligns to 1:336/336 of 4mlcA
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
28% identity, 91% coverage: 29:376/382 of query aligns to 1:335/335 of 4q6bA
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
26% identity, 89% coverage: 31:370/382 of query aligns to 2:346/350 of 3td9A
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
28% identity, 85% coverage: 31:354/382 of query aligns to 3:322/348 of 4gnrA
4eygB Crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with vanillic acid (see paper)
28% identity, 77% coverage: 29:324/382 of query aligns to 2:295/364 of 4eygB
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
26% identity, 79% coverage: 29:330/382 of query aligns to 2:323/376 of 4q6wA
3i45A Crystal structure of putative twin-arginine translocation pathway signal protein from rhodospirillum rubrum atcc 11170
24% identity, 73% coverage: 50:329/382 of query aligns to 23:306/378 of 3i45A
4jb0A Rhodopseudomonas palustris (strain cga009) rp1789 transport protein (see paper)
28% identity, 75% coverage: 56:343/382 of query aligns to 19:303/367 of 4jb0A
4dqdA The crystal structure of a transporter in complex with 3-phenylpyruvic acid (see paper)
25% identity, 61% coverage: 68:300/382 of query aligns to 33:266/361 of 4dqdA
Sites not aligning to the query:
>H281DRAFT_02405 H281DRAFT_02405 amino acid/amide ABC transporter substrate-binding protein, HAAT family
MQHKMTQLAGAALVAAMSLAGTANAQSTDDVKIGFAGPMTGAQAHYGKDFQNGITLAVED
INATKPVIGGKPVRFVLDSADDQADPRTGTTVAQKLVDDGIKGMLGHFNSGTTIPASRIY
ANAGIPEIAMATAPEYTQQGFKTTFRMMTSDTQQGSVAGTFAVKTLGVKKIVIVDDRTAY
GQGLADQFEKAAKAAGGTIVDREYTNDKAVDFKSILTKLKAANPDLIYYGGADSQAAPMV
KQMKALGIKAPLMGGEMVHTPTFIQIAGDAANGTVASLAGLPLEEMPGGKDYVAKYKKRF
NEDVQTYSPYAYDGAMAMFAAMKKANSTDPAKYLPVLAKTSMPAVTSSNLSYDAKGDLKN
GGITLYKVVDGKWTTLQSVGGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory