Comparing H281DRAFT_02421 FitnessBrowser__Burk376:H281DRAFT_02421 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7l82AAA Putative acetyl transferase protein (see paper)
32% identity, 95% coverage: 1:203/214 of query aligns to 6:215/216 of 7l82AAA
7l81AAA Putative acetyl transferase protein (see paper)
32% identity, 95% coverage: 1:203/214 of query aligns to 6:215/216 of 7l81AAA
7l7zAAA Putative acetyl transferase protein (see paper)
32% identity, 95% coverage: 1:203/214 of query aligns to 6:215/216 of 7l7zAAA
7l7yAAA Putative acetyl transferase protein (see paper)
32% identity, 95% coverage: 1:203/214 of query aligns to 6:215/217 of 7l7yAAA
4ea9A X-ray structure of gdp-perosamine n-acetyltransferase in complex with transition state analog at 0.9 angstrom resolution (see paper)
36% identity, 67% coverage: 60:203/214 of query aligns to 62:205/207 of 4ea9A
Sites not aligning to the query:
4ea8A X-ray crystal structure of perb from caulobacter crescentus in complex with coenzyme a and gdp-n-acetylperosamine at 1 angstrom resolution (see paper)
36% identity, 67% coverage: 60:203/214 of query aligns to 62:205/207 of 4ea8A
Sites not aligning to the query:
4eaaA X-ray crystal structure of the h141n mutant of perosamine n- acetyltransferase from caulobacter crescentus in complex with coa and gdp-perosamine (see paper)
35% identity, 67% coverage: 60:203/214 of query aligns to 64:207/210 of 4eaaA
Sites not aligning to the query:
7txsA X-ray structure of the viob n-aetyltransferase from acinetobacter baumannii in the presence of a reaction intermediate (see paper)
29% identity, 96% coverage: 1:205/214 of query aligns to 6:206/209 of 7txsA
7txqA X-ray structure of the viob n-acetyltransferase from acinetobacter baumannii in the present of tdp and acetyl-coenzymea (see paper)
29% identity, 96% coverage: 1:205/214 of query aligns to 6:206/209 of 7txqA
7txpA X-ray structure of the viob n-acetyltransferase from acinetobacter baumannii in complex with tdp-4-amino-4,6-dideoxy-d-glucose (see paper)
29% identity, 96% coverage: 1:205/214 of query aligns to 6:206/209 of 7txpA
P71063 UDP-N-acetylbacillosamine N-acetyltransferase; EC 2.3.1.203 from Bacillus subtilis (strain 168) (see paper)
34% identity, 66% coverage: 62:203/214 of query aligns to 65:206/216 of P71063
3bssA Pgld from campylobacter jejuni, nctc 11168, with native substrate (see paper)
25% identity, 94% coverage: 1:202/214 of query aligns to 8:192/194 of 3bssA
2vheA Pgld-coa complex: an acetyl transferase from campylobacter jejuni (see paper)
25% identity, 94% coverage: 1:202/214 of query aligns to 8:192/194 of 2vheA
Sites not aligning to the query:
3bsyA Pgld from campylobacter jejuni, nctc 11168, in complex with acetyl coenzyme a (see paper)
25% identity, 94% coverage: 1:202/214 of query aligns to 7:191/193 of 3bsyA
Q0P9D1 UDP-N-acetylbacillosamine N-acetyltransferase; Protein glycosylation D; UDP-4-amino-4,6-dideoxy-N-acetyl-alpha-D-glucosamine N-acetyltransferase; EC 2.3.1.203 from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) (see 2 papers)
25% identity, 94% coverage: 1:202/214 of query aligns to 9:193/195 of Q0P9D1
5t2yA Crystal structure of c. Jejuni pgld in complex with 5-methyl-4- (methylamino)-2-phenethylthieno[2,3-d]pyrimidine-6-carboxylic acid (see paper)
25% identity, 94% coverage: 1:202/214 of query aligns to 8:190/192 of 5t2yA
4m99A Acetyltransferase domain of pglb from neisseria gonorrhoeae fa1090 in complex with acetyl coenzyme a (see paper)
29% identity, 94% coverage: 1:202/214 of query aligns to 7:204/206 of 4m99A
5tyhA Pgld from campylobacter jejuni nctc 11168 in complex with 5-(2- furanyl)-1h-pyrazole-3-carboxylic acid (see paper)
27% identity, 68% coverage: 57:202/214 of query aligns to 36:183/185 of 5tyhA
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
33% identity, 51% coverage: 101:210/214 of query aligns to 56:187/200 of 1krrA
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 51% coverage: 101:210/214 of query aligns to 57:188/203 of P07464
Sites not aligning to the query:
>H281DRAFT_02421 FitnessBrowser__Burk376:H281DRAFT_02421
VYGAGGFGKEVMDVARRQNAVSRRWDQICFVDDIREERTFYGTQVLRFNDAEVAGHLDQA
KFVIAVGEPAGREKLGNKLREAGARLGQVIDVSSLVAGTVSLGEGLVVTPLCSISSDAQL
GRNVCVNTMSIVGHDVQVGENTVVSSMVNIGGACVIGANSYLGMGALIKEGVRIGSNSIV
GMGSVVYSDIPDDVIALGNPARVARPNTDRKVFK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory