SitesBLAST
Comparing H281DRAFT_02458 FitnessBrowser__Burk376:H281DRAFT_02458 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
44% identity, 100% coverage: 1:997/1000 of query aligns to 1:963/965 of Q50LF0
- A139 (≠ T179) binding
- D158 (= D198) binding
- E159 (≠ D199) binding
- R160 (≠ Q200) binding
- T166 (≠ S206) binding
- V205 (≠ A244) binding
- A418 (= A456) binding
- L423 (≠ F461) binding
- T425 (≠ L463) binding
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
45% identity, 100% coverage: 1:997/1000 of query aligns to 1:963/965 of 2gagA
- active site: L350 (≠ V388), L375 (= L413), D677 (= D713)
- binding flavin mononucleotide: K510 (= K547), R511 (= R548), T517 (≠ F554), Q521 (= Q558), T549 (= T585), R551 (= R587)
- binding 2-furoic acid: N647 (= N683), G653 (≠ P689), T655 (≠ S691), K851 (= K886)
- binding nicotinamide-adenine-dinucleotide: V134 (= V174), G135 (= G175), G137 (= G177), P138 (= P178), A139 (≠ T179), D158 (= D198), E159 (≠ D199), R160 (≠ Q200), G165 (= G205), T166 (≠ S206), T204 (= T243), V205 (≠ A244), T249 (= T287), G250 (= G288), S295 (≠ D333), F381 (≠ W419), G417 (= G455), A418 (= A456), L423 (≠ F461), D424 (≠ T462), T425 (≠ L463), Y554 (= Y590)
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
44% identity, 99% coverage: 10:997/1000 of query aligns to 13:962/963 of 3ad7A
- active site: L349 (≠ V388), L374 (= L413), D676 (= D713)
- binding flavin mononucleotide: K509 (= K547), R510 (= R548), T516 (≠ F554), Q520 (= Q558), T548 (= T585), R550 (= R587)
- binding nicotinamide-adenine-dinucleotide: G134 (= G175), G136 (= G177), P137 (= P178), A138 (≠ T179), D157 (= D198), E158 (≠ D199), R159 (≠ Q200), T165 (≠ S206), V204 (≠ A244), T248 (= T287), A249 (≠ G288), S294 (≠ D333), F380 (≠ W419), G416 (= G455), L422 (≠ F461), D423 (≠ T462), T424 (≠ L463)
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
44% identity, 99% coverage: 10:997/1000 of query aligns to 13:962/963 of 1vrqA
- active site: L349 (≠ V388), L374 (= L413), D676 (= D713)
- binding flavin mononucleotide: K509 (= K547), R510 (= R548), T516 (≠ F554), Q520 (= Q558), T548 (= T585), R550 (= R587)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (= L668), Y663 (= Y700), G677 (= G714), H690 (≠ T727), I774 (= I810), F776 (= F812), E783 (= E819), K822 (= K858), F824 (≠ Y860)
- binding nicotinamide-adenine-dinucleotide: G134 (= G175), G136 (= G177), P137 (= P178), A138 (≠ T179), D157 (= D198), E158 (≠ D199), R159 (≠ Q200), T165 (≠ S206), V204 (≠ A244), T248 (= T287), A249 (≠ G288), S294 (≠ D333), F380 (≠ W419), G416 (= G455), L422 (≠ F461), D423 (≠ T462), T424 (≠ L463)
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
45% identity, 100% coverage: 1:997/1000 of query aligns to 1:965/967 of Q46337
- M1 (= M1) modified: Initiator methionine, Removed
- G139 (= G177) mutation to A: Does not affect activity and binding of NAD(+).
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
30% identity, 38% coverage: 610:990/1000 of query aligns to 1:356/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
30% identity, 38% coverage: 610:990/1000 of query aligns to 1:356/362 of 1wopA
- active site: D96 (= D713)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (≠ L668), L55 (≠ D672), Y83 (= Y700), D96 (= D713), V98 (= V715), E106 (≠ H723), L108 (≠ M725), V110 (≠ T727), N112 (≠ T729), I137 (≠ V758), E160 (≠ H781), Y168 (≠ F792), Y169 (≠ M793), K173 (≠ E797), S174 (≠ G798), I175 (≠ T799), E180 (≠ A804), T181 (≠ S805), Y188 (≠ F812), E195 (= E819), M197 (≠ N821), R227 (≠ M851), Y236 (= Y860)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
30% identity, 38% coverage: 610:990/1000 of query aligns to 1:356/362 of 1wooA
- active site: D96 (= D713)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (≠ L668), Y83 (= Y700), D96 (= D713), V98 (= V715), V110 (≠ T727), N112 (≠ T729), Y168 (≠ F792), Y169 (≠ M793), Y188 (≠ F812), E195 (= E819), Y236 (= Y860)
Sites not aligning to the query:
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
28% identity, 40% coverage: 598:1000/1000 of query aligns to 463:858/866 of Q9UI17
- A530 (≠ G661) to G: in dbSNP:rs1805073
- S646 (≠ H781) to P: in dbSNP:rs1805074
Sites not aligning to the query:
- 59:60 binding
- 80:81 binding
- 87:95 binding
- 91 modified: Tele-8alpha-FAD histidine
- 109 H → R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- 219 binding
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
28% identity, 37% coverage: 632:1000/1000 of query aligns to 446:814/824 of 4pabB
- active site: E536 (≠ D713)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ Y700), E536 (≠ D713), T538 (≠ V715), I550 (≠ T727), F612 (= F792), L613 (≠ M793), Y632 (≠ F812), E639 (= E819), F680 (≠ Y860), Y700 (≠ G880)
Sites not aligning to the query:
- active site: 53, 102, 226, 255
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 35, 36, 37, 43, 44, 45, 47, 48, 49, 50, 51, 175, 204, 205, 207, 226, 228, 326, 328, 353, 355, 356, 357, 358
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 37% coverage: 632:1000/1000 of query aligns to 483:851/857 of Q63342
Sites not aligning to the query:
- 52:53 binding
- 73:74 binding
- 80:88 binding
- 84 modified: Tele-8alpha-FAD histidine
- 212 binding
- 244 binding
- 390:395 binding
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
28% identity, 39% coverage: 610:996/1000 of query aligns to 430:827/830 of Q9AGP8
- Y539 (= Y700) binding
- D552 (= D713) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 174 binding
- 225 Important for catalytic activity; H→Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
28% identity, 39% coverage: 610:996/1000 of query aligns to 427:824/827 of 1pj7A
- active site: D549 (= D713)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (= L668), Y536 (= Y700), D549 (= D713), T551 (≠ V715), G563 (= G731), F629 (≠ M793), Y648 (≠ F812), E655 (= E819), Y696 (= Y860)
Sites not aligning to the query:
- active site: 222, 256
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 170, 171, 200, 201, 203, 222, 256, 331, 357, 358, 359, 360
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
28% identity, 39% coverage: 610:996/1000 of query aligns to 428:825/828 of 1pj6A
Sites not aligning to the query:
- active site: 223, 257
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50, 172, 201, 202, 204, 223, 257, 331, 332, 358, 359, 360, 361
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
27% identity, 39% coverage: 610:996/1000 of query aligns to 427:824/827 of 3gsiA
- active site: A549 (≠ D713)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (= L668), Y536 (= Y700), T551 (≠ V715), G563 (= G731), F629 (≠ M793), Y648 (≠ F812), E655 (= E819), Y696 (= Y860)
Sites not aligning to the query:
- active site: 222, 256
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 170, 171, 200, 201, 203, 222, 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
28% identity, 39% coverage: 610:996/1000 of query aligns to 437:821/824 of Q8GAI3
Sites not aligning to the query:
- 66 mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- 67 H→A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
26% identity, 38% coverage: 611:989/1000 of query aligns to 2:355/363 of 3a8iA
- active site: D97 (= D713)
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: M51 (≠ L668), Y84 (= Y700), D97 (= D713), I99 (≠ V715), V111 (≠ T727), N113 (≠ T729), F173 (= F792), Y188 (≠ F812), E195 (= E819), R223 (≠ M851), M232 (≠ Y860), W252 (≠ G880)
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
26% identity, 38% coverage: 601:981/1000 of query aligns to 24:387/403 of P48728
- D129 (= D713) mutation D->A,N: Loss of aminomethyltransferase activity.
- N145 (≠ T729) to I: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs386833682
- E232 (= E819) binding
- R261 (≠ M851) binding
- G269 (= G859) to D: in GCE2; decreased aminomethyltransferase activity; dbSNP:rs121964981
- R320 (≠ Q906) to H: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs121964985
Sites not aligning to the query:
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
26% identity, 37% coverage: 610:981/1000 of query aligns to 2:356/371 of 1wsvA
- active site: D98 (= D713)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: M53 (≠ L668), L85 (≠ Y700), D98 (= D713), L99 (≠ G714), I100 (≠ V715), V112 (≠ T727), N114 (≠ T729), F173 (= F792), G193 (≠ S811), Y194 (≠ F812), E201 (= E819), R230 (≠ M851), L239 (≠ Y860)
Sites not aligning to the query:
3tfjA Dmsp-dependent demethylase from p. Ubique - with cofactor thf (see paper)
25% identity, 31% coverage: 656:960/1000 of query aligns to 51:340/369 of 3tfjA
- active site: D108 (= D713)
- binding (6s)-5,6,7,8-tetrahydrofolate: E63 (≠ L668), Y95 (= Y700), D108 (= D713), V110 (= V715), S122 (≠ T727), I123 (≠ T728), A124 (≠ T729), F178 (≠ M793), W197 (≠ F812), E204 (= E819), Y265 (≠ L881)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_02458 FitnessBrowser__Burk376:H281DRAFT_02458
MSQKDRLPNGGRINRALPLTFTFNGRQYQGYQGDTLASALLANGLHFVARSWKYHRPRGI
VTAGVEEPNAVVQLETGAYTVPNARATEVELYQGLVANSVNAKPSIEKDRMAVNQKLARF
IPAGFYYKTFMWPRKFWPKYEEVIRDAAGLGKAPEQLDADRYDKCFAHCDVLVVGGGPTG
LAAAHAAALSGARVTLVDDQPELGGSLLSCRAEIDGKPALQWVHKIEDELRQMPDVKILT
RSTAFGYQDHNLVTVTQRLTDHLPVSQRKGTRELMWKIRAKRVILATGAHERPIVFGNND
LPGVMLASAVSTYLHRYAVLPGRNAVVFTNNDDGYQCALDLKAAGAQVTVIDPRAGESKG
TLPALARRYGVKVIGGAVITAAHGKLRVASVDIASYANGKTGAKQSELPCDLLAMSGGWS
PVLHLFAQSGGKAHWHNEKACFVPGKAMQAETSVGACNGDFTLGQGIRFAVDAGIEAARA
AGHIVARPNPVQVAEISEAKLEPLWLVGGRELATRGPKQFVDFQNDVSAADIFLAAREGF
ESVEHVKRYTAMGFGTDQGKLGNINGMAILAQALGKTIPETGTTTFRPNYTPVTFGTFAG
RELGEFLDPVRKTAVHEWHVENGAAFEDVGNWKRPWYYPKAGEDMHAAVARESLAVRTSV
GILDASTLGKIDIQGPDSAKLLNWVYTNPWSKLEVGKCRYGLMLDENGMIFDDGVTVRLA
DQHYMMTTTTGGAARVLTWLERWLQTEWPDMRVRLASVTDHWATFAVVGPNSRKVLQKVC
HDIDFANAAFPFMSYREGTVAGAASRVMRISFSGELAYEVNVPANVGRAVWEALMAAGAE
FDITPYGTETMHVLRAEKGYIIVGQDTDGSMTPYDLGMGGLVAKSKDFLGKRSLTRSDTA
KPGRKQLVGLLSDDPSFVIPEGSQIVAGPFQGDTAPMLGHVTSSYYSPILKRSIAMAVVK
GGLEKIGETVTVPLSSGKQIAAKITSSVFYDSEGARQHVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory