SitesBLAST
Comparing H281DRAFT_02514 FitnessBrowser__Burk376:H281DRAFT_02514 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
52% identity, 97% coverage: 9:258/258 of query aligns to 8:256/256 of 3h81A
- active site: A64 (= A65), M69 (= M70), T79 (≠ S80), F83 (≠ I84), G107 (= G109), E110 (= E112), P129 (= P131), E130 (= E132), V135 (≠ I137), P137 (= P139), G138 (= G140), L223 (= L225), F233 (= F235)
- binding calcium ion: F233 (= F235), Q238 (= Q240)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
52% identity, 99% coverage: 1:255/258 of query aligns to 1:254/255 of 3q0jC
- active site: A65 (= A65), M70 (= M70), T80 (≠ S80), F84 (≠ I84), G108 (= G109), E111 (= E112), P130 (= P131), E131 (= E132), V136 (≠ I137), P138 (= P139), G139 (= G140), L224 (= L225), F234 (= F235)
- binding acetoacetyl-coenzyme a: Q23 (≠ N23), A24 (≠ P24), L25 (= L25), A27 (≠ P27), A63 (= A63), G64 (= G64), A65 (= A65), D66 (= D66), I67 (= I67), K68 (≠ V68), M70 (= M70), F84 (≠ I84), G107 (= G108), G108 (= G109), E111 (= E112), P130 (= P131), E131 (= E132), P138 (= P139), G139 (= G140), M140 (≠ A141)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
52% identity, 99% coverage: 1:255/258 of query aligns to 1:254/255 of 3q0gC
- active site: A65 (= A65), M70 (= M70), T80 (≠ S80), F84 (≠ I84), G108 (= G109), E111 (= E112), P130 (= P131), E131 (= E132), V136 (≠ I137), P138 (= P139), G139 (= G140), L224 (= L225), F234 (= F235)
- binding coenzyme a: L25 (= L25), A63 (= A63), I67 (= I67), K68 (≠ V68), Y104 (= Y105), P130 (= P131), E131 (= E132), L134 (= L135)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
51% identity, 98% coverage: 6:258/258 of query aligns to 6:260/260 of 2hw5C
- active site: A68 (= A65), M73 (= M70), S83 (= S80), L87 (≠ I84), G111 (= G109), E114 (= E112), P133 (= P131), E134 (= E132), T139 (≠ I137), P141 (= P139), G142 (= G140), K227 (≠ L225), F237 (= F235)
- binding crotonyl coenzyme a: K26 (≠ N23), A27 (≠ P24), L28 (= L25), A30 (≠ P27), K62 (= K59), I70 (= I67), F109 (≠ L107)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
50% identity, 98% coverage: 6:258/258 of query aligns to 6:260/260 of 1dubA
- active site: A68 (= A65), M73 (= M70), S83 (= S80), L87 (≠ I84), G111 (= G109), E114 (= E112), P133 (= P131), E134 (= E132), T139 (≠ I137), P141 (= P139), G142 (= G140), K227 (≠ L225), F237 (= F235)
- binding acetoacetyl-coenzyme a: K26 (≠ N23), A27 (≠ P24), L28 (= L25), A30 (≠ P27), A66 (= A63), A68 (= A65), D69 (= D66), I70 (= I67), Y107 (= Y105), G110 (= G108), G111 (= G109), E114 (= E112), P133 (= P131), E134 (= E132), L137 (= L135), G142 (= G140), F233 (= F231), F249 (= F247)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
50% identity, 98% coverage: 6:258/258 of query aligns to 4:258/258 of 1ey3A
- active site: A66 (= A65), M71 (= M70), S81 (= S80), L85 (≠ I84), G109 (= G109), E112 (= E112), P131 (= P131), E132 (= E132), T137 (≠ I137), P139 (= P139), G140 (= G140), K225 (≠ L225), F235 (= F235)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ N23), L26 (= L25), A28 (≠ P27), A64 (= A63), G65 (= G64), A66 (= A65), D67 (= D66), I68 (= I67), L85 (≠ I84), W88 (= W88), G109 (= G109), P131 (= P131), L135 (= L135), G140 (= G140)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
50% identity, 98% coverage: 6:258/258 of query aligns to 36:290/290 of P14604
- E144 (= E112) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E132) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
51% identity, 98% coverage: 6:258/258 of query aligns to 6:258/258 of 1mj3A
- active site: A68 (= A65), M73 (= M70), S83 (≠ I84), L85 (≠ R86), G109 (= G109), E112 (= E112), P131 (= P131), E132 (= E132), T137 (≠ I137), P139 (= P139), G140 (= G140), K225 (≠ L225), F235 (= F235)
- binding hexanoyl-coenzyme a: K26 (≠ N23), A27 (≠ P24), L28 (= L25), A30 (≠ P27), A66 (= A63), G67 (= G64), A68 (= A65), D69 (= D66), I70 (= I67), G109 (= G109), P131 (= P131), E132 (= E132), L135 (= L135), G140 (= G140)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
52% identity, 96% coverage: 9:255/258 of query aligns to 8:249/250 of 3q0gD
- active site: A64 (= A65), M69 (= M70), T75 (≠ S80), F79 (≠ I84), G103 (= G109), E106 (= E112), P125 (= P131), E126 (= E132), V131 (≠ I137), P133 (= P139), G134 (= G140), L219 (= L225), F229 (= F235)
- binding Butyryl Coenzyme A: F225 (= F231), F241 (= F247)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
50% identity, 98% coverage: 6:258/258 of query aligns to 5:254/254 of 2dubA
- active site: A67 (= A65), M72 (= M70), S82 (= S80), G105 (= G109), E108 (= E112), P127 (= P131), E128 (= E132), T133 (≠ I137), P135 (= P139), G136 (= G140), K221 (≠ L225), F231 (= F235)
- binding octanoyl-coenzyme a: K25 (≠ N23), A26 (≠ P24), L27 (= L25), A29 (≠ P27), A65 (= A63), A67 (= A65), D68 (= D66), I69 (= I67), K70 (≠ V68), G105 (= G109), E108 (= E112), P127 (= P131), E128 (= E132), G136 (= G140), A137 (= A141)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
41% identity, 100% coverage: 1:258/258 of query aligns to 1:259/259 of 5zaiC
- active site: A65 (= A65), F70 (≠ M70), S82 (≠ D82), R86 (= R86), G110 (= G109), E113 (= E112), P132 (= P131), E133 (= E132), I138 (= I137), P140 (= P139), G141 (= G140), A226 (≠ L225), F236 (= F235)
- binding coenzyme a: K24 (≠ P24), L25 (= L25), A63 (= A63), G64 (= G64), A65 (= A65), D66 (= D66), I67 (= I67), P132 (= P131), R166 (≠ P165), F248 (= F247), K251 (≠ R250)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
35% identity, 98% coverage: 5:258/258 of query aligns to 4:257/257 of 6slbAAA
- active site: Q64 (≠ A65), F69 (≠ M70), L80 (≠ S80), N84 (≠ G85), A108 (≠ G109), S111 (≠ E112), A130 (≠ P131), F131 (≠ E132), L136 (≠ I137), P138 (= P139), D139 (≠ G140), A224 (≠ L225), G234 (≠ F235)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ K59), A62 (= A63), Q64 (≠ A65), D65 (= D66), L66 (≠ I67), Y76 (= Y75), A108 (≠ G109), F131 (≠ E132), D139 (≠ G140)
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
34% identity, 96% coverage: 11:258/258 of query aligns to 12:261/261 of 5jbxB
- active site: A67 (= A65), R72 (≠ M70), L84 (≠ S80), R88 (≠ G85), G112 (= G109), E115 (= E112), T134 (≠ P131), E135 (= E132), I140 (= I137), P142 (= P139), G143 (= G140), A228 (≠ L225), L238 (≠ F235)
- binding coenzyme a: S24 (≠ N23), R25 (≠ P24), R26 (≠ L25), A28 (≠ P27), A65 (= A63), D68 (= D66), L69 (≠ I67), K70 (≠ V68), L110 (= L107), G111 (= G108), T134 (≠ P131), E135 (= E132), L138 (= L135), R168 (≠ P165)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
34% identity, 98% coverage: 5:258/258 of query aligns to 1:245/245 of 6slaAAA
- active site: Q61 (≠ A65), L68 (≠ K72), N72 (≠ G85), A96 (≠ G109), S99 (≠ E112), A118 (≠ P131), F119 (≠ E132), L124 (≠ I137), P126 (= P139), N127 (≠ G140), A212 (≠ L225), G222 (≠ F235)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (= L25), A59 (= A63), Q61 (≠ A65), D62 (= D66), L63 (≠ I67), L68 (≠ K72), Y71 (= Y75), A94 (≠ L107), G95 (= G108), A96 (≠ G109), F119 (≠ E132), I122 (≠ L135), L124 (≠ I137), N127 (≠ G140), F234 (= F247), K237 (≠ R250)
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
31% identity, 83% coverage: 44:256/258 of query aligns to 51:266/270 of Q4WF54
Sites not aligning to the query:
- 268:270 PTS1-type peroxisomal targeting signal
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
31% identity, 97% coverage: 9:258/258 of query aligns to 13:266/266 of O53561
- K135 (≠ L127) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 127:134, 50% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (= K134) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
32% identity, 97% coverage: 6:255/258 of query aligns to 10:253/260 of 2uzfA
- active site: G70 (≠ A65), R80 (≠ Y75), L84 (≠ F79), G108 (= G109), V111 (≠ E112), T130 (≠ P131), G131 (≠ E132), S136 (≠ I137), D138 (≠ P139), A139 (≠ G140), A225 (= A233), Y233 (≠ F235)
- binding acetoacetyl-coenzyme a: V28 (≠ P24), R29 (≠ L25), S68 (≠ A63), G69 (= G64), G70 (≠ A65), D71 (= D66), Y104 (= Y105), G108 (= G109)
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
33% identity, 97% coverage: 6:255/258 of query aligns to 15:266/273 of Q5HH38
- R34 (≠ L25) binding in other chain
- SGGD---Q 73:77 (≠ AGADIVAM 63:70) binding in other chain
- S149 (≠ I137) binding in other chain
3h02A 2.15 angstrom resolution crystal structure of naphthoate synthase from salmonella typhimurium.
32% identity, 94% coverage: 13:255/258 of query aligns to 32:259/266 of 3h02A
- active site: G82 (≠ A65), H86 (≠ A69), L90 (= L73), G114 (= G109), V117 (≠ E112), G137 (≠ E132), S142 (≠ I137), D144 (≠ P139), G145 (= G140), A231 (≠ L224), Y239 (≠ F235)
- binding bicarbonate ion: G113 (= G108), Q135 (= Q130), G137 (≠ E132), W165 (≠ C160)
4elwA Structure of e. Coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with nitrate (see paper)
31% identity, 97% coverage: 6:255/258 of query aligns to 22:260/267 of 4elwA
- active site: G83 (≠ A65), L91 (= L73), G115 (= G109), V118 (≠ E112), G138 (≠ E132), S143 (≠ I137), D145 (≠ P139), G146 (= G140), A232 (≠ L224), Y240 (≠ F235)
- binding nitrate ion: G114 (= G108), T137 (≠ P131), G138 (≠ E132), F144 (≠ V138), W166 (≠ C160)
Query Sequence
>H281DRAFT_02514 FitnessBrowser__Burk376:H281DRAFT_02514
MSAAMIRSERRGRVALVRLASDNPLNPLTDALMDQLIDVLLRNEADPQVHATVLTGSGKA
FAAGADIVAMSKLDYANAFSDDYIGRSWDRIRTVRKPIIAAVGGYALGGGCELAMMCDIV
IAADDALFGQPEIKLGIVPGAGGTQRLPRAVGKSTAMLACLTGEPLGAQEALAYGLVSKI
VARERLIDEAMRVGEQIARHSLPVIVAIKEAVDRAFESSLSEGLLFERRLFHAGFSLADQ
KEGMAAFLERRQAAFQNR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory