Comparing H281DRAFT_02516 FitnessBrowser__Burk376:H281DRAFT_02516 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 71% coverage: 64:387/457 of query aligns to 182:502/616 of P36035
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 49% coverage: 16:241/457 of query aligns to 40:270/583 of Q9Y7Q9
Sites not aligning to the query:
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 50% coverage: 15:241/457 of query aligns to 45:292/572 of O42885
Sites not aligning to the query:
>H281DRAFT_02516 FitnessBrowser__Burk376:H281DRAFT_02516
MSTTSGARDPQPGMLRIIATSSIGTMLEYYDFFVYVALTSTLTHLFLPSTDRMIATMAGV
ATFGIAYVARPLGTIIFSPMADRIGRKKTFVITLAIMGIATVGIGCLPTYAMAGLLAPIG
LVTLRVVQGIALGGEYGSAVVYVMEHAPAGRKGMATSVLQSTASLGLLLALAIVSALKFA
LDASAFESWGWRVPFLISAPIVAVATWIRLGMTETPVFAEMKQAGRLSKSPLQDTLSSAT
SWKAILVAMFGAQGGTSVSLYTSIVYMLYFLQNVLKVEPSRANLCLGIAIVVAAPLYPVF
GRLSDAIGRSRVMLIGIVLWILAAYPAFAGIRTNALAGGWAMVTLLVALLAVLTAMIMAP
LPAFIAECFPPQSRTTGFGLSQQLGNVLFGGFLPLISLSLVNLTGNPLAGVGYSIVSLLP
CLAVTYFWGLRQDRLIRQRSHEVQCASRANAGQLPVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory