Comparing H281DRAFT_02528 FitnessBrowser__Burk376:H281DRAFT_02528 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
50% identity, 99% coverage: 2:277/278 of query aligns to 7:278/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
50% identity, 99% coverage: 2:277/278 of query aligns to 7:278/290 of 8gsrA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
46% identity, 75% coverage: 70:278/278 of query aligns to 69:276/279 of 6v77B
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
39% identity, 77% coverage: 66:278/278 of query aligns to 63:277/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
39% identity, 77% coverage: 66:278/278 of query aligns to 63:277/280 of 6j5xA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
37% identity, 100% coverage: 1:277/278 of query aligns to 2:274/277 of 6iymA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
39% identity, 74% coverage: 72:277/278 of query aligns to 94:301/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
39% identity, 74% coverage: 72:277/278 of query aligns to 93:300/303 of 8skyB
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
40% identity, 74% coverage: 72:277/278 of query aligns to 19:219/224 of Q6P587
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
40% identity, 74% coverage: 72:277/278 of query aligns to 14:214/218 of 6fogA
Sites not aligning to the query:
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
34% identity, 90% coverage: 22:271/278 of query aligns to 28:254/265 of 3r6oA
1gttA Crystal structure of hpce (see paper)
42% identity, 66% coverage: 65:248/278 of query aligns to 216:392/421 of 1gttA
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
40% identity, 74% coverage: 72:277/278 of query aligns to 13:213/216 of 6sbiA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
43% identity, 67% coverage: 92:278/278 of query aligns to 73:248/252 of 3qdfA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
35% identity, 75% coverage: 70:278/278 of query aligns to 61:267/269 of 4dbhA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
35% identity, 73% coverage: 76:278/278 of query aligns to 29:231/233 of 6j5yA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
31% identity, 72% coverage: 71:270/278 of query aligns to 16:222/224 of 3v77A
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
32% identity, 75% coverage: 70:278/278 of query aligns to 76:261/264 of 6jvwB
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
29% identity, 69% coverage: 74:264/278 of query aligns to 12:219/247 of 1nkqA
3bqbX Hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase (see paper)
29% identity, 68% coverage: 83:272/278 of query aligns to 104:281/291 of 3bqbX
>H281DRAFT_02528 FitnessBrowser__Burk376:H281DRAFT_02528
MKLFRFGPVGAEKPGVVDRNGTHRDLSAVIADIDPATIAAGLESRLANLDLTTLPEVPKG
TRFGPCIAQPGNFLAIGLNYVEHAKETNAPLPEEPILFNKAPSCIVGPDDDIVLPRGSEK
TDWEVELAFVIGKRAHYVSEADALSYVFGYCVCNDVSERAFQLERGGQWVKGKCAPSFGP
IGPYLVTAEEIPDPQKLPLWLEVNGERVQNSDTSDMIFSIRTIVSYVSQFVVLMPGDLIT
TGTPPGVGLGMKPERYLKRGDTVRLSVEGLGTQTQRVV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory