Comparing H281DRAFT_02529 FitnessBrowser__Burk376:H281DRAFT_02529 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4k28A 2.15 angstrom resolution crystal structure of a shikimate dehydrogenase family protein from pseudomonas putida kt2440 in complex with NAD+ (see paper)
37% identity, 95% coverage: 11:267/270 of query aligns to 2:261/266 of 4k28A
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
28% identity, 97% coverage: 9:269/270 of query aligns to 6:276/288 of 3tnlA
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
28% identity, 97% coverage: 9:269/270 of query aligns to 9:279/291 of 3tozA
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
28% identity, 97% coverage: 9:269/270 of query aligns to 9:279/291 of Q8Y9N5
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
26% identity, 93% coverage: 9:258/270 of query aligns to 2:242/269 of 2hk9A
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
26% identity, 93% coverage: 9:258/270 of query aligns to 2:242/267 of 2hk9B
1npdB X-ray structure of shikimate dehydrogenase complexed with NAD+ from e.Coli (ydib) northeast structural genomics research consortium (nesg) target er24 (see paper)
28% identity, 93% coverage: 7:258/270 of query aligns to 1:262/288 of 1npdB
P0A6D5 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Escherichia coli (strain K12) (see 4 papers)
28% identity, 93% coverage: 7:258/270 of query aligns to 1:262/288 of P0A6D5
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
26% identity, 93% coverage: 9:258/270 of query aligns to 2:242/269 of O67049
1o9bA Quinate/shikimate dehydrogenase ydib complexed with nadh (see paper)
29% identity, 90% coverage: 15:258/270 of query aligns to 3:256/280 of 1o9bA
3pgjA 2.49 angstrom resolution crystal structure of shikimate 5- dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate
30% identity, 90% coverage: 16:259/270 of query aligns to 4:245/272 of 3pgjA
Q9KVT3 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
30% identity, 90% coverage: 16:259/270 of query aligns to 8:249/278 of Q9KVT3
3sefA 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
29% identity, 90% coverage: 16:259/270 of query aligns to 4:241/268 of 3sefA
Q8ZPR4 Quinate/shikimate dehydrogenase; NAD-dependent shikimate 5-dehydrogenase; EC 1.1.1.282 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
28% identity, 93% coverage: 7:258/270 of query aligns to 1:262/288 of Q8ZPR4
P43876 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see paper)
28% identity, 91% coverage: 15:259/270 of query aligns to 3:246/272 of P43876
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
28% identity, 72% coverage: 16:209/270 of query aligns to 4:195/271 of 1nytA
Sites not aligning to the query:
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
28% identity, 72% coverage: 16:209/270 of query aligns to 4:195/272 of P15770
Sites not aligning to the query:
2o7sA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
28% identity, 94% coverage: 13:266/270 of query aligns to 234:474/500 of 2o7sA
Sites not aligning to the query:
1p77A Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae (see paper)
29% identity, 70% coverage: 15:202/270 of query aligns to 3:188/265 of 1p77A
Sites not aligning to the query:
3sefC 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. N16961 in complex with shikimate and NADPH
31% identity, 69% coverage: 16:202/270 of query aligns to 4:187/244 of 3sefC
Sites not aligning to the query:
>H281DRAFT_02529 FitnessBrowser__Burk376:H281DRAFT_02529
MNTASFIPVTGATALYAIVGDPVSQVRSPQVVNALFAQAQIDALLIPMHVSRDRFGETMR
SLMAIGNLRGIVITVPFKVDAMSLVSHVLPGAQAAGALNAMRRLPDNRWEGDMFDGAGLV
RALDDAGHPPAGKRVLLVGAGGAGRAIAIALAQSGVREIELSDIDGERVRQVVEAVVNAA
PSCVCRVSEPTFDDHDLVVNATPLGMKPDDALPVDIAGMNAQHVLFDIVPKPDVTALMRA
AQSQGVTTIGGKRMIEGQARALAGFFGHRV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory