Comparing H281DRAFT_02531 FitnessBrowser__Burk376:H281DRAFT_02531 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P77455 Bifunctional protein PaaZ; EC 3.3.2.12; EC 1.2.1.91 from Escherichia coli (strain K12) (see paper)
35% identity, 76% coverage: 20:142/161 of query aligns to 531:658/681 of P77455
Sites not aligning to the query:
6jqoA Structure of paaz, a bifunctional enzyme in complex with NADP+ and ccoa (see paper)
35% identity, 76% coverage: 20:142/161 of query aligns to 530:657/678 of 6jqoA
Sites not aligning to the query:
6jqnA Structure of paaz, a bifunctional enzyme in complex with NADP+ and ocoa (see paper)
35% identity, 76% coverage: 20:142/161 of query aligns to 530:657/678 of 6jqnA
Sites not aligning to the query:
6jqmA Structure of paaz with NADPH (see paper)
35% identity, 76% coverage: 20:142/161 of query aligns to 530:657/678 of 6jqmA
Sites not aligning to the query:
O32472 (R)-specific enoyl-CoA hydratase; EC 4.2.1.119 from Aeromonas caviae (Aeromonas punctata) (see 2 papers)
33% identity, 69% coverage: 47:157/161 of query aligns to 29:134/134 of O32472
Sites not aligning to the query:
A0A3Q7HWE4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FERN, mitochondrial; 3-hydroxyl-ACP dehydratase FERN; Protein FERN-LIKE; SlFERN; EC 4.2.1.59 from Solanum lycopersicum (Tomato) (Lycopersicon esculentum) (see paper)
26% identity, 80% coverage: 30:158/161 of query aligns to 29:152/165 of A0A3Q7HWE4
7svtB Mycobacterium tuberculosis 3-hydroxyl-acp dehydratase hadab in complex with 1,3-diarylpyrazolyl-acylsulfonamide inhibitor (see paper)
36% identity, 41% coverage: 20:85/161 of query aligns to 5:70/141 of 7svtB
P86397 Hydroxyacyl-thioester dehydratase type 2, mitochondrial; HsHTD2; 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; EC 4.2.1.59 from Homo sapiens (Human) (see paper)
30% identity, 75% coverage: 37:157/161 of query aligns to 49:163/168 of P86397
Sites not aligning to the query:
4v12A Crystal structure of the msmeg_6754 dehydratase from mycobacterium smegmatis (see paper)
33% identity, 43% coverage: 15:83/161 of query aligns to 198:266/337 of 4v12A
Sites not aligning to the query:
P9WNP3 3-hydroxyacyl-thioester dehydratase Z; 3-hydroxybutyryl-CoA dehydratase; Enoyl-CoA hydratase 2; N-related protein; Nodulation protein; EC 4.2.1.-; EC 4.2.1.55; EC 4.2.1.119 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 55% coverage: 34:121/161 of query aligns to 24:114/151 of P9WNP3
>H281DRAFT_02531 FitnessBrowser__Burk376:H281DRAFT_02531
MSDSVANDTRRLLKPGLYGLNDIEAGDYYLTAGVTVTETHVVNFAGVSGDYYDIHVDDVA
AQEAGFPGRIAHGLLGLSLADGLKTRCPVLLKGLATLGWNWSFRAPLMIGDRIHVDIEVI
GKRPTKRPDRGIATLRLKVLNQRGEVVQEGETLMMMPTTLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory