SitesBLAST
Comparing H281DRAFT_02574 FitnessBrowser__Burk376:H281DRAFT_02574 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
23% identity, 89% coverage: 38:419/431 of query aligns to 30:412/824 of Q8GAI3
- W66 (≠ G73) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ R74) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 82% coverage: 33:387/431 of query aligns to 1:342/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ V39), G8 (= G40), G10 (= G42), V11 (≠ F43), I12 (≠ T44), V30 (≠ L62), E31 (≠ D63), K32 (≠ A64), E38 (≠ G70), A39 (= A71), S40 (= S72), A43 (≠ N75), G45 (= G77), L46 (≠ I80), V171 (= V213), G200 (≠ T242), G201 (≠ N243), W203 (≠ Y245), G298 (= G345), R300 (≠ V347), P301 (≠ A348), Y326 (≠ N371), R327 (≠ G372), N328 (≠ R373), G329 (= G374), I330 (= I375)
3sglA The crystal structure of mnmc from yersinia pestis bound with fad and sam (see paper)
28% identity, 48% coverage: 35:242/431 of query aligns to 233:430/630 of 3sglA
- binding flavin-adenine dinucleotide: I237 (≠ V39), G238 (= G40), G239 (≠ A41), G240 (= G42), I241 (≠ F43), V242 (≠ T44), A262 (= A64), D263 (vs. gap), A270 (= A71), S271 (= S72), N273 (≠ R74), A277 (≠ Q78), E401 (≠ A212), L402 (≠ V213), T430 (= T242)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 450, 473, 534, 583, 584, 585, 586, 587, 588
- binding s-adenosylmethionine: 33, 34, 35, 36, 37, 38, 39, 68, 69, 123, 124, 145, 146, 147
3pvcA Crystal structure of apo mnmc from yersinia pestis (see paper)
27% identity, 48% coverage: 35:242/431 of query aligns to 236:434/635 of 3pvcA
- binding flavin-adenine dinucleotide: I240 (≠ V39), G241 (= G40), G242 (≠ A41), G243 (= G42), I244 (≠ F43), V245 (≠ T44), A265 (= A64), D266 (vs. gap), A273 (= A71), S274 (= S72), N276 (≠ R74), A280 (≠ Q78), E404 (≠ A212), L405 (≠ V213), T434 (= T242)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 437, 454, 456, 477, 538, 588, 589, 590, 591, 592, 593
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
24% identity, 82% coverage: 34:387/431 of query aligns to 5:344/369 of S5FMM4
- G51 (≠ I80) mutation to S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- A54 (≠ L83) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- K81 (≠ I117) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ T242) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (= I375) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L385) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
24% identity, 45% coverage: 187:382/431 of query aligns to 148:339/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ A212), V174 (= V213), S202 (≠ T242), G203 (≠ N243), W205 (≠ Y245), F209 (≠ L249), G300 (= G345), R302 (≠ V347), H327 (≠ Y370), F328 (≠ N371), R329 (≠ G372), N330 (≠ R373), G331 (= G374), I332 (= I375)
- binding glycolic acid: Y246 (= Y294), R302 (≠ V347), R329 (≠ G372)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
24% identity, 45% coverage: 187:382/431 of query aligns to 148:339/369 of O31616
- V174 (= V213) binding
- H244 (≠ S288) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ V347) binding
- 327:333 (vs. 370:376, 29% identical) binding
- R329 (≠ G372) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
24% identity, 45% coverage: 187:382/431 of query aligns to 148:339/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (= Y294), R302 (≠ V347), R329 (≠ G372)
- binding flavin-adenine dinucleotide: V174 (= V213), S202 (≠ T242), G203 (≠ N243), W205 (≠ Y245), F209 (≠ L249), G300 (= G345), R302 (≠ V347), H327 (≠ Y370), R329 (≠ G372), N330 (≠ R373), G331 (= G374), I332 (= I375)
- binding phosphate ion: R254 (= R302)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
Query Sequence
>H281DRAFT_02574 FitnessBrowser__Burk376:H281DRAFT_02574
MIEVKEGAALPDSLWAATAQPAPDTPPLRESASFDVAIVGAGFTGLSTALHLAERGVKVC
VLDAAEPGWGASGRNGGQVIPGLKYDPDELVQRFGETAGNRLVEVVGGAADNVFDLIDRY
GIECSAVRSGWIQPAPSRAMLEAVTRRARQWEARGAKVSLLDGAEVSRRLGTKSYIGGWI
DHRAGSIQPLSYVRGLARAAQSLGVAVHGRTAVSRLMRNERGWRVETQGGASVEAQRVVV
ATNGYTGALWPGLRQSVIAANSFIVATRPLPTGIGDDILRGGEVASDSRRLLLYFRRDAA
GRLLMGGRGPFSEPSANGDWAHLERAVELMYPQLKGIGYEYRWAGRVAITADFLPHVHEP
APGLSIALGYNGRGIAMATTVGKHLAERMCSGSAAAFPFAVTPVRSIPFHGLQRFYITAG
VAWYRLMDAIA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory