Comparing H281DRAFT_02575 FitnessBrowser__Burk376:H281DRAFT_02575 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ezlA Rice l-galactose dehydrogenase (holo form)
26% identity, 94% coverage: 17:320/325 of query aligns to 18:308/318 of 7ezlA
7eziA Rice l-galactose dehydrogenase (apo form)
26% identity, 94% coverage: 17:320/325 of query aligns to 23:313/323 of 7eziA
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
26% identity, 90% coverage: 12:305/325 of query aligns to 11:311/326 of P77256
7svqA Crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with NAD+ (see paper)
26% identity, 88% coverage: 9:295/325 of query aligns to 9:278/315 of 7svqA
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
26% identity, 84% coverage: 19:292/325 of query aligns to 22:285/311 of 1pz0A
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
26% identity, 84% coverage: 19:292/325 of query aligns to 23:286/310 of P46336
Q9GV41 9,11-endoperoxide prostaglandin H2 reductase; Prostaglandin F2-alpha synthase; EC 1.1.1.- from Trypanosoma brucei brucei
30% identity, 71% coverage: 7:237/325 of query aligns to 8:204/276 of Q9GV41
Sites not aligning to the query:
1vbjA The crystal structure of prostaglandin f synthase from trypanosoma brucei
30% identity, 71% coverage: 7:237/325 of query aligns to 13:209/281 of 1vbjA
Sites not aligning to the query:
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
23% identity, 85% coverage: 19:293/325 of query aligns to 17:265/298 of 1ynqB
Sites not aligning to the query:
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
23% identity, 85% coverage: 19:293/325 of query aligns to 17:265/298 of 1ynpB
Sites not aligning to the query:
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
29% identity, 81% coverage: 30:292/325 of query aligns to 26:269/301 of 6ow0B
Sites not aligning to the query:
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
29% identity, 81% coverage: 30:292/325 of query aligns to 30:293/323 of 6ow0A
Sites not aligning to the query:
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
28% identity, 64% coverage: 21:229/325 of query aligns to 24:213/337 of Q3L181
4gieA Crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to NADP (see paper)
27% identity, 69% coverage: 2:226/325 of query aligns to 11:201/288 of 4gieA
Sites not aligning to the query:
4fziA Crystal structure of prostaglandin f synthase from trypanosoma cruzi (see paper)
28% identity, 67% coverage: 8:226/325 of query aligns to 6:190/277 of 4fziA
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
27% identity, 74% coverage: 14:253/325 of query aligns to 1:224/287 of 3v0sA
Sites not aligning to the query:
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
23% identity, 66% coverage: 18:233/325 of query aligns to 22:211/274 of 5danA
Sites not aligning to the query:
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
23% identity, 66% coverage: 18:233/325 of query aligns to 23:212/275 of 6kiyA
Sites not aligning to the query:
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
23% identity, 66% coverage: 18:233/325 of query aligns to 23:212/275 of 6kikA
Sites not aligning to the query:
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
22% identity, 85% coverage: 19:293/325 of query aligns to 17:250/283 of 1ynpA
Sites not aligning to the query:
>H281DRAFT_02575 FitnessBrowser__Burk376:H281DRAFT_02575
MNARIAKLNGAVLLPRVGVGAGSLANAAGEQAFFNMIHAAWASGVRYFDTSAAYLGGESE
QRLGAALAACPREELYVSTKLGRYLSQPGASSLPGGSNFYLDYTYDTTLRSVERSLSRLK
VDRLDAVFIHDLDPGFAQAAYREELKTAVEGAFPALQRLKDEKVVGAIGVASMDWQACLD
FAEMADVDVVMPAGEYSLLRTRSTALLEHCVEKGIAWIAASPFNSGILATGSRPDAFYNM
RPATRQVLSQTEGLECICRRHDVPLATAALLFPLRHPAVSTIVFGAKTSDEFNESFARLS
GNLPDQFWHEMDAFLTKTKDWEKHD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory