Comparing H281DRAFT_02578 FitnessBrowser__Burk376:H281DRAFT_02578 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3n9tA Cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
52% identity, 85% coverage: 9:253/288 of query aligns to 8:251/286 of 3n9tA
Q5PXQ6 Hydroxyquinol 1,2-dioxygenase; 1,2-HQD; EC 1.13.11.37 from Nocardioides simplex (Arthrobacter simplex) (see paper)
48% identity, 98% coverage: 6:286/288 of query aligns to 13:292/293 of Q5PXQ6
1tmxA Crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e (see paper)
48% identity, 98% coverage: 6:286/288 of query aligns to 12:291/292 of 1tmxA
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
36% identity, 81% coverage: 24:257/288 of query aligns to 27:260/309 of 2azqA
P07773 Catechol 1,2-dioxygenase; 1,2-CTD; EC 1.13.11.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
34% identity, 95% coverage: 11:284/288 of query aligns to 18:292/311 of P07773
1dmhA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound 4-methylcatechol (see paper)
34% identity, 95% coverage: 11:284/288 of query aligns to 16:290/309 of 1dmhA
1dltA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound catechol (see paper)
34% identity, 95% coverage: 11:284/288 of query aligns to 16:290/309 of 1dltA
1dlmA Structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data (see paper)
34% identity, 95% coverage: 11:284/288 of query aligns to 16:290/309 of 1dlmA
5td3A Crystal structure of catechol 1,2-dioxygenase from burkholderia vietnamiensis
33% identity, 94% coverage: 18:287/288 of query aligns to 21:291/307 of 5td3A
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
39% identity, 67% coverage: 95:286/288 of query aligns to 73:255/256 of 3i51A
Sites not aligning to the query:
3i4yA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
39% identity, 67% coverage: 95:286/288 of query aligns to 73:255/256 of 3i4yA
Sites not aligning to the query:
3i4vA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol (see paper)
39% identity, 67% coverage: 95:286/288 of query aligns to 73:255/256 of 3i4vA
3hjsA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol (see paper)
39% identity, 67% coverage: 95:286/288 of query aligns to 73:255/256 of 3hjsA
Sites not aligning to the query:
3hjqA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol (see paper)
39% identity, 67% coverage: 95:286/288 of query aligns to 73:255/256 of 3hjqA
Sites not aligning to the query:
3hhyA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol (see paper)
39% identity, 67% coverage: 95:286/288 of query aligns to 73:255/256 of 3hhyA
Sites not aligning to the query:
3hhxA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
39% identity, 67% coverage: 95:286/288 of query aligns to 73:255/256 of 3hhxA
Sites not aligning to the query:
3hgiA Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp (see paper)
39% identity, 67% coverage: 95:286/288 of query aligns to 75:257/258 of 3hgiA
3o6rA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
30% identity, 91% coverage: 22:284/288 of query aligns to 2:253/256 of 3o6rA
3o6jA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with hydroxyquinol (see paper)
30% identity, 91% coverage: 22:284/288 of query aligns to 2:253/256 of 3o6jA
3o32A Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
30% identity, 91% coverage: 22:284/288 of query aligns to 2:253/256 of 3o32A
>H281DRAFT_02578 FitnessBrowser__Burk376:H281DRAFT_02578
MRNFSEDNITAAVIERLAGSTSKRVHQISDALVRHLHAFVKEIEPTEDEWAAAIRFLTQT
GQMCTDTRQEFILLSDTLGVSMLVDAINHRYPGDATQTTVLGPFYVEEAAELPLGASIAD
GEPGEPLLVEGTVRDLNGKPIAGALVETWHADSHGFYDVQKAAGKTELHMRARFLTDADG
AFWYRSIVPAAYPIPNDGPVGRMLDAQGRHPYRPAHVHFRVSAPGFETLVTHVFVSGDVY
LDSDVVFGVKDALIEPLVPLAPGLSPAGHRVDVPGALLAYDFVLPPQN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory