SitesBLAST
Comparing H281DRAFT_02581 FitnessBrowser__Burk376:H281DRAFT_02581 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
44% identity, 94% coverage: 17:257/257 of query aligns to 7:251/251 of 6d9yB
- active site: G20 (= G30), S145 (= S151), Y158 (= Y164)
- binding nicotinamide-adenine-dinucleotide: G16 (= G26), R19 (= R29), G20 (= G30), D40 (= D50), L41 (≠ N51), V64 (= V70), D65 (= D71), Q66 (≠ L72), A93 (= A99), S145 (= S151), Y158 (= Y164), K162 (= K168), P188 (= P194), A189 (= A195), A190 (≠ I196), A191 (≠ T197), T193 (= T199)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
38% identity, 92% coverage: 17:253/257 of query aligns to 6:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G26), S17 (≠ A28), R18 (= R29), I20 (= I31), T40 (≠ S55), N62 (≠ D71), V63 (≠ L72), N89 (= N98), A90 (= A99), I92 (= I101), V139 (= V149), S141 (= S151), Y154 (= Y164), K158 (= K168), P184 (= P194), G185 (≠ A195), I187 (≠ T197), T189 (= T199), M191 (≠ L201)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 93% coverage: 16:253/257 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G30), N111 (≠ D123), S139 (= S151), Q149 (≠ I161), Y152 (= Y164), K156 (= K168)
- binding acetoacetyl-coenzyme a: D93 (≠ P104), K98 (≠ D110), S139 (= S151), N146 (≠ H158), V147 (≠ P159), Q149 (≠ I161), Y152 (= Y164), F184 (≠ I196), M189 (≠ L201), K200 (≠ A212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G26), N17 (≠ R29), G18 (= G30), I19 (= I31), D38 (= D50), F39 (vs. gap), V59 (= V70), D60 (= D71), V61 (≠ L72), N87 (= N98), A88 (= A99), G89 (= G100), I90 (= I101), T137 (≠ V149), S139 (= S151), Y152 (= Y164), K156 (= K168), P182 (= P194), F184 (≠ I196), T185 (= T197), T187 (= T199), M189 (≠ L201)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
38% identity, 92% coverage: 17:253/257 of query aligns to 3:240/244 of 6t77A
- active site: G16 (= G30), S138 (= S151), Y151 (= Y164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G26), S14 (≠ A28), R15 (= R29), T37 (≠ N51), L58 (vs. gap), N59 (≠ D71), V60 (≠ L72), A87 (= A99), G88 (= G100), I89 (= I101)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 92% coverage: 17:253/257 of query aligns to 3:240/244 of P0A2C9
- M125 (= M138) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A236) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S237) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
42% identity, 93% coverage: 16:253/257 of query aligns to 5:244/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G26), R18 (= R29), G19 (= G30), I20 (= I31), D39 (= D50), R40 (≠ N51), C63 (≠ V70), I65 (≠ L72), N91 (= N98), G93 (= G100), I94 (= I101), V114 (= V122), Y155 (= Y164), K159 (= K168), I188 (≠ T197), T190 (= T199), T193 (≠ F202)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
38% identity, 92% coverage: 17:253/257 of query aligns to 6:239/243 of 4i08A
- active site: G19 (= G30), N113 (≠ D123), S141 (= S151), Q151 (≠ I161), Y154 (= Y164), K158 (= K168)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G26), S17 (≠ A28), R18 (= R29), I20 (= I31), T40 (≠ S55), N62 (≠ D71), V63 (≠ L72), N89 (= N98), A90 (= A99), G140 (≠ A150), S141 (= S151), Y154 (= Y164), K158 (= K168), P184 (= P194), G185 (≠ A195), T189 (= T199)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
38% identity, 91% coverage: 20:253/257 of query aligns to 5:243/246 of 3osuA
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 92% coverage: 17:253/257 of query aligns to 3:240/244 of P0AEK2
- GASR 12:15 (≠ GAAR 26:29) binding
- T37 (≠ C48) binding
- NV 59:60 (≠ DL 71:72) binding
- N86 (= N98) binding
- Y151 (= Y164) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSAAK 164:168) binding
- A154 (= A167) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K168) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ T197) binding
- E233 (≠ F246) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
37% identity, 92% coverage: 17:253/257 of query aligns to 2:239/243 of 1q7bA
- active site: G15 (= G30), E101 (≠ A115), S137 (= S151), Q147 (≠ I161), Y150 (= Y164), K154 (= K168)
- binding calcium ion: E232 (≠ F246), T233 (≠ I247)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G26), S13 (≠ A28), R14 (= R29), T36 (≠ C48), N58 (≠ D71), V59 (≠ L72), N85 (= N98), A86 (= A99), G87 (= G100), I88 (= I101), S137 (= S151), Y150 (= Y164), K154 (= K168), P180 (= P194), G181 (≠ A195), I183 (≠ T197)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
38% identity, 91% coverage: 20:253/257 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G30), S138 (= S151), Q148 (≠ I161), Y151 (= Y164), K155 (= K168)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G26), S10 (≠ A28), R11 (= R29), I13 (= I31), N31 (= N51), Y32 (≠ D52), A33 (≠ V53), G34 (≠ S54), S35 (= S55), A58 (vs. gap), N59 (≠ D71), V60 (≠ L72), N86 (= N98), A87 (= A99), T109 (≠ V122), S138 (= S151), Y151 (= Y164), K155 (= K168), P181 (= P194), G182 (≠ A195)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
35% identity, 92% coverage: 17:253/257 of query aligns to 3:244/248 of 6ixmC
- active site: G16 (= G30), S142 (= S151), Y155 (= Y164), K159 (= K168)
- binding nicotinamide-adenine-dinucleotide: G12 (= G26), S15 (≠ R29), G16 (= G30), I17 (= I31), D36 (= D50), I37 (vs. gap), A61 (≠ V70), D62 (= D71), T63 (≠ L72), N89 (= N98), A90 (= A99), M140 (≠ V149), S142 (= S151), Y155 (= Y164), K159 (= K168), P185 (= P194), A186 (= A195), Y187 (≠ I196), I188 (≠ T197), L192 (= L201)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
36% identity, 92% coverage: 17:253/257 of query aligns to 2:239/243 of 1q7cA
- active site: G15 (= G30), S137 (= S151), Q147 (≠ I161), F150 (≠ Y164), K154 (= K168)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G26), S13 (≠ A28), R14 (= R29), A35 (= A47), T36 (≠ C48), L57 (≠ V70), N58 (≠ D71), V59 (≠ L72), G87 (= G100), I88 (= I101)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
36% identity, 92% coverage: 17:253/257 of query aligns to 2:239/243 of 7emgB
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 92% coverage: 17:253/257 of query aligns to 3:244/248 of 4urfB
- active site: G16 (= G30), S142 (= S151), I152 (= I161), Y155 (= Y164), K159 (= K168)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M219), R211 (≠ G220), R212 (= R221)
- binding bicarbonate ion: I92 (= I101), G94 (= G103), R109 (= R118), R179 (≠ T188), S228 (= S237)
- binding nicotinamide-adenine-dinucleotide: G12 (= G26), G14 (≠ A28), N15 (≠ R29), G16 (= G30), I17 (= I31), D36 (vs. gap), I37 (vs. gap), D62 (= D71), T63 (≠ L72), N89 (= N98), A90 (= A99), G91 (= G100), I140 (≠ V149), Y155 (= Y164), K159 (= K168), P185 (= P194), A186 (= A195), I188 (≠ T197), T190 (= T199)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 92% coverage: 17:253/257 of query aligns to 3:244/248 of 4urfA
- active site: G16 (= G30), S142 (= S151), I152 (= I161), Y155 (= Y164), K159 (= K168)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I101), S93 (≠ N102), G94 (= G103), E95 (≠ P104), T97 (≠ V106), E101 (≠ D110), T103 (≠ P112), Q106 (≠ A115), R109 (= R118), S175 (≠ G184), G177 (= G186)
- binding magnesium ion: S237 (≠ F246), Y238 (≠ I247)
- binding nicotinamide-adenine-dinucleotide: G12 (= G26), G14 (≠ A28), N15 (≠ R29), G16 (= G30), I17 (= I31), D36 (vs. gap), I37 (vs. gap), W41 (= W49), D62 (= D71), T63 (≠ L72), N89 (= N98), A90 (= A99), G91 (= G100), I140 (≠ V149), Y155 (= Y164), K159 (= K168), P185 (= P194), I188 (≠ T197), T190 (= T199)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 92% coverage: 17:253/257 of query aligns to 3:244/248 of 4ureB
- active site: G16 (= G30), S142 (= S151), I152 (= I161), Y155 (= Y164), K159 (= K168)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ R29), G16 (= G30), I17 (= I31), N89 (= N98), G91 (= G100), Y155 (= Y164), P185 (= P194), A186 (= A195)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
37% identity, 93% coverage: 16:253/257 of query aligns to 1:251/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G26), T13 (≠ A28), S14 (≠ R29), G15 (= G30), I16 (= I31), G35 (≠ D52), F36 (≠ V53), L60 (= L72), N86 (= N98), G88 (= G100), I89 (= I101), A137 (= A150), Y151 (= Y164), K155 (= K168), P181 (= P194), G182 (≠ A195), V184 (≠ T197), T186 (= T199)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 92% coverage: 17:253/257 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G30), S142 (= S151), Q152 (≠ I161), Y155 (= Y164), K159 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G26), S14 (≠ A28), R15 (= R29), G16 (= G30), I17 (= I31), N35 (= N51), Y36 (≠ D52), N37 (≠ V53), G38 (≠ S54), S39 (= S55), N63 (≠ D71), V64 (≠ L72), N90 (= N98), A91 (= A99), I93 (= I101), I113 (≠ V122), S142 (= S151), Y155 (= Y164), K159 (= K168), P185 (= P194), I188 (≠ T197), T190 (= T199)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
37% identity, 92% coverage: 17:253/257 of query aligns to 2:251/255 of 2q2qD
- active site: G15 (= G30), S138 (= S151), Y151 (= Y164), K155 (= K168), R196 (≠ H209)
- binding nicotinamide-adenine-dinucleotide: G11 (= G26), T13 (≠ A28), S14 (≠ R29), G15 (= G30), I16 (= I31), F36 (vs. gap), D59 (= D71), L60 (= L72), N86 (= N98), G88 (= G100), L109 (≠ V122), I136 (≠ V149), S138 (= S151), Y151 (= Y164), K155 (= K168), P181 (= P194), G182 (≠ A195), W183 (≠ I196), V184 (≠ T197), T186 (= T199), L188 (= L201), V189 (≠ F202)
Query Sequence
>H281DRAFT_02581 FitnessBrowser__Burk376:H281DRAFT_02581
MEEQTNMEMQPLKQRRFEARTAIVTGAARGIGRGIAQRLAEEGCRIACWDNDVSSLESGD
GSFAALVQDVDLADARAVEAAFAATLESFGHVDIVVNNAGINGPVVPIEDYPVDAWNRLL
AVDLNSVFHTCRLAVPHMRARGAGRIVNVASIVGKEGHPNICAYSAAKAGVIGLTKSIAR
ELAGTGVTVNGIAPAITETDLFREMTEEHIEASKARIPMGRFLTVPEIAAMVAWIASDEC
SFTTGFIFDLSGGRATY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory