Comparing H281DRAFT_02615 FitnessBrowser__Burk376:H281DRAFT_02615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
67% identity, 88% coverage: 27:245/248 of query aligns to 5:225/226 of 8eyzA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
44% identity, 88% coverage: 26:242/248 of query aligns to 5:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
44% identity, 88% coverage: 26:242/248 of query aligns to 5:226/226 of 4zv1A
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
36% identity, 93% coverage: 16:245/248 of query aligns to 2:234/241 of 2q2aA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
36% identity, 91% coverage: 21:245/248 of query aligns to 1:228/235 of 2pvuA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
37% identity, 88% coverage: 27:245/248 of query aligns to 3:224/231 of 2q2cA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
40% identity, 87% coverage: 26:241/248 of query aligns to 11:228/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
37% identity, 87% coverage: 27:241/248 of query aligns to 12:227/229 of 6svfA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
36% identity, 86% coverage: 29:241/248 of query aligns to 18:234/235 of 4g4pA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
35% identity, 87% coverage: 26:241/248 of query aligns to 2:222/224 of 4ymxA
2pyyB Crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate (see paper)
35% identity, 78% coverage: 48:241/248 of query aligns to 19:210/217 of 2pyyB
Sites not aligning to the query:
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
34% identity, 86% coverage: 29:241/248 of query aligns to 10:226/230 of 4kqpA
8b5dA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
35% identity, 87% coverage: 26:240/248 of query aligns to 1:219/223 of 8b5dA
6fxgB Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
34% identity, 87% coverage: 26:240/248 of query aligns to 4:222/226 of 6fxgB
8b5eA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
34% identity, 87% coverage: 26:240/248 of query aligns to 3:221/225 of 8b5eA
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
35% identity, 85% coverage: 25:236/248 of query aligns to 16:231/239 of 4zefA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
32% identity, 87% coverage: 27:241/248 of query aligns to 6:226/234 of 3k4uE
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
32% identity, 90% coverage: 18:241/248 of query aligns to 19:253/260 of P02911
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
32% identity, 88% coverage: 25:241/248 of query aligns to 1:228/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
31% identity, 89% coverage: 22:241/248 of query aligns to 1:231/238 of 1lstA
>H281DRAFT_02615 FitnessBrowser__Burk376:H281DRAFT_02615
MKLAAKLAVAAVAAFSFASGAAYAETLLVACDTAFVPFEFKQGNEYVGFDIDLWKEIAKD
LRIDYKLQPMDFSGILPALQTHNVDVALAGITIKDERKKVIDFSDGYYASGFTLMVPADS
TIKGPDDLKGKTLAVKTGTSSFDYAKANFKNTDLRAFPNIDNAYLELATGRVDAAMHDTP
NVLYYIHTAGKSRVKAVGPQMMAQQYGIAFPKGSPLVAQVNAELVKIKADGRYAAIYKKW
FGVEPAKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory