Comparing H281DRAFT_02621 FitnessBrowser__Burk376:H281DRAFT_02621 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
40% identity, 95% coverage: 15:439/447 of query aligns to 33:447/448 of 6io1B
Sites not aligning to the query:
5ghgB Transaminase w58l with smba
39% identity, 94% coverage: 18:436/447 of query aligns to 32:425/433 of 5ghgB
Sites not aligning to the query:
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
35% identity, 94% coverage: 15:435/447 of query aligns to 72:488/504 of Q94CE5
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
38% identity, 96% coverage: 15:443/447 of query aligns to 28:450/453 of 6g4dB
Sites not aligning to the query:
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
38% identity, 96% coverage: 15:443/447 of query aligns to 28:450/451 of 6g4fA
Sites not aligning to the query:
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
38% identity, 96% coverage: 15:443/447 of query aligns to 28:450/451 of 6g4eA
Sites not aligning to the query:
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
37% identity, 93% coverage: 15:431/447 of query aligns to 29:441/449 of 5lh9D
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
37% identity, 93% coverage: 15:431/447 of query aligns to 27:439/447 of 5lhaA
6s54A Transaminase from pseudomonas fluorescens (see paper)
37% identity, 93% coverage: 19:435/447 of query aligns to 37:448/453 of 6s54A
Sites not aligning to the query:
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
36% identity, 94% coverage: 15:436/447 of query aligns to 31:443/450 of 6gwiB
Sites not aligning to the query:
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
36% identity, 94% coverage: 15:436/447 of query aligns to 36:454/460 of 5kr6B
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
34% identity, 94% coverage: 14:435/447 of query aligns to 27:444/459 of D6R3B6
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
36% identity, 94% coverage: 15:436/447 of query aligns to 32:450/455 of 5kr5A
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
34% identity, 93% coverage: 15:428/447 of query aligns to 2:403/423 of 4a6rA
4e3qA Pmp-bound form of aminotransferase crystal structure from vibrio fluvialis (see paper)
34% identity, 94% coverage: 15:436/447 of query aligns to 31:445/452 of 4e3qA
Sites not aligning to the query:
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
35% identity, 94% coverage: 21:440/447 of query aligns to 41:458/458 of 3fcrA
Sites not aligning to the query:
7q9xAAA Probable aminotransferase
35% identity, 93% coverage: 15:428/447 of query aligns to 31:435/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
35% identity, 93% coverage: 15:428/447 of query aligns to 31:435/455 of 4a6tC
Sites not aligning to the query:
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
33% identity, 96% coverage: 15:443/447 of query aligns to 3:422/422 of 7qx3A
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
35% identity, 93% coverage: 15:428/447 of query aligns to 3:407/427 of 4ba5A
>H281DRAFT_02621 FitnessBrowser__Burk376:H281DRAFT_02621
MTTVFHRAPRASLPIAVRGDGIEIVDSTGTRYIDACGGAAVSCLGHSHPRVIEAIQRQVQ
QLPYAHTSFFTTEPAEALADLLIEAAPRNLGHVYFVSGGSEAMEAALKLARQYFVEKGQP
ERRHFIARRQSYHGNTLGALAIGGNAWRREPFLPILIEAHHVTPCFAYREQQAGETDEAF
AQRLADELEAKILELGAQSVAAFVAETVVGATAGAVPPVREYFRKIRAVCDKYGVLLILD
EVMSGMGRTGHLFACEEDGVSPDILAIAKGLGAGYQPIGATLVSNEIFNTIVGGSGFFQH
GHTYIGHATACAAALEVQKVIAEEQLLDNVKARGEQLRARLREWQANHPFIGDVRGRGLF
TGVELVQDRASKTAFDPKHKLHAIIKSEAMKRGLMVYPMGGTVDGRIGDHVLIAPPFITT
SAQIDTIVERLADAIDGALGLIGVKVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory