Comparing H281DRAFT_02632 FitnessBrowser__Burk376:H281DRAFT_02632 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
27% identity, 91% coverage: 27:283/283 of query aligns to 25:281/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
24% identity, 90% coverage: 29:283/283 of query aligns to 28:296/296 of P68183
>H281DRAFT_02632 FitnessBrowser__Burk376:H281DRAFT_02632
MYPLPVEHWKPWSRTLYKASLPVALFVWLLPMLAVLITSIRSSDELSQGDYWAWPKHFAL
IDNYGAALTQTPMLHYFANSMLITVPSVLGAILLASMAGFALATYRFRGNIVVLFTFVAG
NFVPVQILMIPVRDMALKVGLFNTVWALIIFHVAFQTGFCTLFLRNFIKQLPFELIEAAR
VEGASEWTIYARIVLPLIRPALAALGILVFTFVWNDYFWALCLTQGDDAAPITVGVAALK
GQWTTAWNLVAAGSVLAALPSVLMFFAMQKHFVAGLTFGASKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory