SitesBLAST
Comparing H281DRAFT_02674 FitnessBrowser__Burk376:H281DRAFT_02674 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
7dqxE Crystal structure of xanthine dehydrogenase family protein
35% identity, 98% coverage: 1:288/293 of query aligns to 1:286/293 of 7dqxE
- binding flavin-adenine dinucleotide: K29 (≠ R28), I30 (≠ V29), I31 (≠ L30), G33 (= G32), G34 (= G33), Q35 (= Q34), S36 (= S35), L37 (= L36), H78 (≠ Q77), I101 (≠ V100), A102 (≠ S101), I106 (= I105), G110 (= G109), T111 (= T110), G113 (= G112), G114 (= G113), S115 (= S114), A117 (≠ C116), A123 (≠ S122), E124 (= E123), I167 (≠ L170), Y193 (= Y196)
1ffuC Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
37% identity, 99% coverage: 1:290/293 of query aligns to 1:287/287 of 1ffuC
- binding flavin-adenine dinucleotide: K29 (≠ R28), L30 (≠ V29), A32 (= A31), G33 (= G32), G34 (= G33), H35 (≠ Q34), S36 (= S35), L37 (= L36), I54 (≠ L53), I101 (≠ V100), A102 (≠ S101), G110 (= G109), T111 (= T110), G114 (= G113), D115 (≠ S114), A117 (≠ C116), N123 (≠ S122), D124 (≠ E123), L161 (= L164), V166 (≠ L169), M167 (≠ L170), W193 (≠ Y196)
1n5wC Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
36% identity, 98% coverage: 1:288/293 of query aligns to 1:285/287 of 1n5wC
P19920 Carbon monoxide dehydrogenase medium chain; CO dehydrogenase subunit M; CO-DH M; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
36% identity, 98% coverage: 1:288/293 of query aligns to 1:285/288 of P19920
4zohB Crystal structure of glyceraldehyde oxidoreductase (see paper)
32% identity, 96% coverage: 1:282/293 of query aligns to 1:269/274 of 4zohB
- active site: Y256 (= Y269)
- binding flavin-adenine dinucleotide: R28 (= R28), P29 (≠ V29), A31 (= A31), G32 (= G32), G33 (= G33), H34 (≠ Q34), S35 (= S35), L36 (= L36), H77 (≠ Q77), I95 (≠ V100), G96 (≠ S101), V100 (≠ I105), T105 (= T110), G108 (= G113), S109 (= S114), S111 (≠ C116), A117 (≠ S122), D118 (≠ E123), L160 (= L169), V161 (≠ L170), D185 (= D195), F186 (≠ Y196)
1t3qC Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
35% identity, 97% coverage: 1:285/293 of query aligns to 1:279/285 of 1t3qC
- binding flavin-adenine dinucleotide: I29 (≠ V29), A31 (= A31), G32 (= G32), G33 (= G33), Q34 (= Q34), S35 (= S35), L36 (= L36), V100 (= V100), A101 (≠ S101), V105 (≠ I105), T110 (= T110), G113 (= G113), S114 (= S114), A116 (≠ C116), A122 (≠ S122), E123 (= E123), L166 (= L170), Y190 (= Y196)
3hrdG Crystal structure of nicotinate dehydrogenase (see paper)
25% identity, 82% coverage: 4:242/293 of query aligns to 2:242/292 of 3hrdG
- binding flavin-adenine dinucleotide: I29 (≠ V29), A31 (= A31), G32 (= G32), G33 (= G33), T34 (≠ Q34), D35 (≠ S35), F77 (≠ Q77), V100 (= V100), G101 (≠ S101), I105 (= I105), T110 (= T110), G113 (= G113), N114 (≠ S114), S116 (≠ C116), T117 (≠ Q117), G122 (≠ S122), D123 (≠ E123), I168 (≠ L169), M169 (≠ L170)
Q0QLF4 Nicotinate dehydrogenase FAD-subunit; NDH; Nicotinic acid hydroxylase FAD-subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
25% identity, 82% coverage: 4:242/293 of query aligns to 2:242/296 of Q0QLF4
- 29:36 (vs. 29:36, 50% identical) binding
- G101 (≠ S101) binding
- TIGGN 110:114 (≠ TLGGS 110:114) binding
- D123 (≠ E123) binding
- R160 (≠ T161) binding
- M169 (≠ L170) binding
- K187 (≠ E188) binding
5g5gB Escherichia coli periplasmic aldehyde oxidase (see paper)
26% identity, 79% coverage: 6:237/293 of query aligns to 4:275/316 of 5g5gB
- binding flavin-adenine dinucleotide: K26 (≠ R28), F27 (≠ V29), A29 (= A31), G30 (= G32), G31 (= G33), T32 (≠ Q34), N33 (≠ S35), L34 (= L36), G98 (≠ V100), A99 (≠ S101), L103 (≠ I105), A107 (≠ G109), T108 (= T110), A110 (≠ G112), G111 (= G113), N112 (≠ S114), L114 (vs. gap), Q115 (vs. gap), S163 (vs. gap), D164 (vs. gap), L212 (= L169), I213 (≠ L170), F239 (≠ Y196)
- binding iron/sulfur cluster: C119 (= C116), C129 (= C126), N130 (≠ F127), K131 (≠ T128), C138 (vs. gap), H148 (vs. gap), C157 (≠ G143), I158 (≠ A144), A159 (≠ V145)
P77324 Aldehyde oxidoreductase FAD-binding subunit PaoB; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
26% identity, 79% coverage: 6:237/293 of query aligns to 4:275/318 of P77324
- 26:34 (vs. 28:36, 44% identical) binding
- T108 (= T110) binding
- C119 (= C116) binding
- C129 (= C126) binding
- C138 (vs. gap) binding
- C157 (≠ G143) binding
- D164 (vs. gap) binding
- I213 (≠ L170) binding
- K230 (≠ E188) binding
1rm6B Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
32% identity, 39% coverage: 4:117/293 of query aligns to 5:118/323 of 1rm6B
- binding flavin-adenine dinucleotide: P29 (≠ V29), G31 (≠ A31), A32 (≠ G32), G33 (= G33), T34 (≠ Q34), D35 (≠ S35), L36 (= L36), L53 (= L53), V101 (= V100), A102 (≠ S101), A110 (≠ G109), T111 (= T110), G114 (= G113), N115 (≠ S114), C117 (= C116), Q118 (= Q117)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 162, 207, 231, 232, 233
- binding iron/sulfur cluster: 122, 124, 138, 146, 147, 148, 155, 156, 157
O33820 4-hydroxybenzoyl-CoA reductase subunit beta; 4-HBCR subunit beta; EC 1.1.7.1 from Thauera aromatica (see paper)
32% identity, 39% coverage: 4:117/293 of query aligns to 5:118/324 of O33820
- 29:36 (vs. 29:36, 38% identical) binding
- T111 (= T110) binding
- N115 (≠ S114) binding
- Q118 (= Q117) binding
Sites not aligning to the query:
5y6qB Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
29% identity, 34% coverage: 27:126/293 of query aligns to 24:130/330 of 5y6qB
- binding flavin-adenine dinucleotide: I26 (≠ V29), A28 (= A31), G29 (= G32), G30 (= G33), T31 (≠ Q34), T32 (≠ S35), Q33 (≠ L36), A97 (≠ V100), A98 (≠ S101), I102 (= I105), A106 (≠ G109), T107 (= T110), G110 (= G113), N111 (≠ S114), R113 (≠ C116), Q114 (= Q117)
- binding iron/sulfur cluster: C118 (vs. gap), Y121 (vs. gap), C130 (= C126)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 164, 165, 213, 214, 232, 241
- binding iron/sulfur cluster: 131, 139, 141, 158, 159, 160
Q06278 Aldehyde oxidase; Aldehyde oxidase 1; Azaheterocycle hydroxylase; EC 1.2.3.1; EC 1.17.3.- from Homo sapiens (Human) (see 3 papers)
22% identity, 83% coverage: 7:250/293 of query aligns to 242:493/1338 of Q06278
- 264:271 (vs. 29:36, 38% identical) binding
- A345 (vs. gap) binding
- S354 (≠ T110) binding
- H358 (≠ S114) binding
- D367 (≠ E123) binding
- L411 (= L170) binding
Sites not aligning to the query:
- 44 binding ; C→W: Disrupts protein stability.
- 49 binding
- 52 binding
- 74 binding
- 113 binding
- 114 binding
- 117 binding
- 149 binding
- 151 binding ; binding
- 802 R → C: decreases homodimerization but nearly no effect on kinetic parameters; dbSNP:rs41309768
- 806:807 binding
- 921 R → H: increases homodimerization; abolishes enzymatic activity on phenanthridine; decreases turnover number with benzaldehyde, phtalazine and chloroquinazolinone as substrate, while nearly no effect on the KM; dbSNP:rs56199635
- 1047 binding
- 1088:1091 binding
- 1135 N → S: increases homodimerization and turnover number with phenanthridine as substrate; nearly no effect on kinetic parameters with benzaldehyde, phtalazine and chloroquinazolinone as substrate; dbSNP:rs55754655
- 1203 binding
- 1268 binding
- 1269 G→R: No effect on dimerization. Loss of oxidase activity.
- 1271 S → L: no effect on dimerization; no effect on oxidase activity; dbSNP:rs141786030
- 1297 H → R: increases homodimerization and turnover number with phenanthridine as substrate; nearly no effect on kinetic parameters with benzaldehyde, phtalazine and chloroquinazolinone as substrate; dbSNP:rs3731722
8emtA Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
22% identity, 83% coverage: 7:250/293 of query aligns to 194:445/1254 of 8emtA
- binding flavin-adenine dinucleotide: P215 (≠ R28), V216 (= V29), I217 (≠ L30), M218 (≠ A31), G219 (= G32), T221 (≠ Q34), S222 (= S35), V223 (≠ L36), L296 (vs. gap), A297 (vs. gap), S306 (≠ T110), G309 (= G113), H310 (≠ S114), I312 (≠ C116), D319 (≠ E123)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 45, 46, 49, 69, 71, 111, 112, 114, 146, 148
7orcB Human aldehyde oxidase in complex with raloxifene (see paper)
22% identity, 83% coverage: 7:250/293 of query aligns to 207:458/1299 of 7orcB
- binding flavin-adenine dinucleotide: P228 (≠ R28), V229 (= V29), I230 (≠ L30), M231 (≠ A31), G232 (= G32), N233 (≠ G33), T234 (≠ Q34), S235 (= S35), V236 (≠ L36), L309 (vs. gap), A310 (vs. gap), A318 (≠ G109), S319 (≠ T110), G322 (= G113), H323 (≠ S114), S326 (≠ Q117), H328 (≠ D119), S331 (= S122), D332 (≠ E123), L376 (= L170), L403 (≠ Y196)
- binding raloxifene: G417 (≠ A209), D418 (≠ Q210), G419 (= G211), H449 (≠ P241), N451 (≠ D243)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148, 716
- binding raloxifene: 506, 507, 616, 619, 740, 743, 746
4uhxA Human aldehyde oxidase in complex with phthalazine and thioridazine (see paper)
22% identity, 83% coverage: 7:250/293 of query aligns to 208:459/1290 of 4uhxA
- binding flavin-adenine dinucleotide: P229 (≠ R28), V230 (= V29), I231 (≠ L30), M232 (≠ A31), G233 (= G32), N234 (≠ G33), T235 (≠ Q34), S236 (= S35), V237 (≠ L36), L310 (vs. gap), A311 (vs. gap), A319 (≠ G109), S320 (≠ T110), G323 (= G113), H324 (≠ S114), I326 (≠ C116), H329 (≠ D119), S332 (= S122), D333 (≠ E123), L377 (= L170), L404 (≠ Y196)
Sites not aligning to the query:
- active site: 732, 767, 843, 847, 875, 1223, 1224
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 111, 112, 114, 146, 148
- binding 10-{2-[(2S)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020, 1079
- binding 10-{2-[(2R)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine: 540, 542, 543, 1014, 1015, 1018, 1019, 1020
8emtB Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
22% identity, 83% coverage: 7:250/293 of query aligns to 189:440/1221 of 8emtB
- binding flavin-adenine dinucleotide: P210 (≠ R28), V211 (= V29), M213 (≠ A31), G214 (= G32), T216 (≠ Q34), S217 (= S35), V218 (≠ L36), L291 (vs. gap), A292 (vs. gap), A300 (≠ G109), G304 (= G113), H305 (≠ S114), I307 (≠ C116), D314 (≠ E123)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 69, 109, 112, 144, 146
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 80% coverage: 8:240/293 of query aligns to 264:506/1361 of Q8GUQ8
- W364 (≠ L99) mutation to A: Decreases activity 8-fold.
- Y421 (= Y159) mutation to A: Decreases activity 4-fold.
Sites not aligning to the query:
- 831 E→A: Loss of activity.
- 909 R→A: Decreases activity 12-fold.
- 1297 E→A: Decreases activity 40-fold.
Query Sequence
>H281DRAFT_02674 FitnessBrowser__Burk376:H281DRAFT_02674
MKPSEFLYHAPTTLDEAVQLLGTLEDARVLAGGQSLMPMMNFRYLMTSHLIDLNGVEALT
RIEQRGDRLHIGAMARQRDIELSPLVIQRAPLIREAYQLVSHKQIRNRGTLGGSLCQLDP
SSEQPCFTAALDGVLTIARYEDGAVTHRELPMSDWAVMYMTPALEEGELLAGISLDIWPE
GHGYAFEEFARRHGDYAIVGVAALCTADAQGNLDRVSLTICGVAPGPVRMHDVETALRGR
PMDDAALRMASDAASALDVMTDAHVSTDYRQHLAGVLTERALKRAFSRVARQS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory