Comparing H281DRAFT_02701 FitnessBrowser__Burk376:H281DRAFT_02701 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P76014 PEP-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 97% coverage: 1:202/208 of query aligns to 1:204/210 of P76014
4lrzA Crystal structure of the e.Coli dhar(n)-dhal complex (see paper)
31% identity, 97% coverage: 2:202/208 of query aligns to 3:205/211 of 4lrzA
Q9CIV7 PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
28% identity, 88% coverage: 26:207/208 of query aligns to 25:192/192 of Q9CIV7
3cr3A Structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis (see paper)
28% identity, 88% coverage: 26:207/208 of query aligns to 25:192/192 of 3cr3A
P45510 Dihydroxyacetone kinase; DHA kinase; Glycerone kinase; EC 2.7.1.29 from Citrobacter freundii (see 2 papers)
29% identity, 96% coverage: 10:208/208 of query aligns to 363:552/552 of P45510
Sites not aligning to the query:
>H281DRAFT_02701 FitnessBrowser__Burk376:H281DRAFT_02701
MSVSNNELRELLTRALNALPAHADELRDLDAALGDGDLGITVRAGSAAVVNALAALPDGA
SLSDVLLAAGKAFSTANPSTFAALVGGGLLAAAKAVPGVQGVGRAEALAIGRAVAGRIVE
RGKSQLGDKTVLDALLPSLDTLEASQGSAVELLDAMIATAQEGVAATASIQSRKGRAAWV
QERSIGHADPGATAYVRFLQALREACAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory