SitesBLAST
Comparing H281DRAFT_02706 FitnessBrowser__Burk376:H281DRAFT_02706 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
P0AB87 L-fuculose phosphate aldolase; D-ribulose-phosphate aldolase; L-fuculose-1-phosphate aldolase; EC 4.1.2.17 from Escherichia coli (strain K12) (see 4 papers)
52% identity, 95% coverage: 5:216/223 of query aligns to 2:210/215 of P0AB87
- T26 (= T29) mutation to A: Decrease of the aldolase activity mostly due to a decrease of the affinity for L-fuculose 1-phosphate (Fuc1P).
- A27 (≠ S30) mutation Missing: Strong decrease of the aldolase activity.
- GN 28:29 (= GN 31:32) binding
- N29 (= N32) mutation to L: Loss of aldolase activity; when associated with A-71.; mutation to Q: Strong decrease of the aldolase activity mostly due to a decrease of the affinity for L-fuculose 1-phosphate (Fuc1P).
- TG 43:44 (≠ SG 46:47) binding
- S71 (= S78) mutation to A: Loss of aldolase activity; when associated with L-29.; mutation to Q: Loss of aldolase activity.
- SS 71:72 (= SS 78:79) binding
- E73 (= E80) active site, Proton donor/acceptor; binding ; mutation to Q: Loss of aldolase activity; when associated with F-113 and F-209.; mutation to S: Loss of aldolase activity.
- H92 (= H99) binding
- H94 (= H101) binding
- Y113 (= Y120) Plays a key role in the stabilization of the transition state and positioning the aldehyde component; mutation to F: Slowly inactivated. Has a preference for the D-aldehyde and shows an inversion of the diastereoselectivity. Loss of aldolase activity; when associated with Q-73 and F-209.
- F131 (= F138) Plays a key role in the stabilization of the transition state and positioning the aldehyde component; mutation to A: Has a slight preference for the D-aldehyde and shows an inversion of the diastereoselectivity. Loss of aldolase activity; when associated with W-206.
- H155 (= H162) binding
- F206 (= F212) mutation to W: Decrease of aldolase activity mostly due to a decrease of the affinity for L-fuculose 1-phosphate (Fuc1P). Loss of aldolase activity; when associated with A-131.
- Y209 (= Y215) Plays a key role in the stabilization of the transition state and positioning the aldehyde component; mutation to F: Slowly inactivated and unable to discriminate between the enantiomers. Shows an inversion of the diastereoselectivity. Loss of aldolase activity; when associated with Q-73 and F-113.
Sites not aligning to the query:
- 207:215 mutation Missing: Loss of aldolase activity. Has a slight preference for the D-aldehyde.
- 211:215 mutation Missing: Decrease of aldolase activity mostly due to a decrease of the affinity for L-fuculose 1-phosphate (Fuc1P).
2fuaA L-fuculose 1-phosphate aldolase crystal form t with cobalt (see paper)
52% identity, 95% coverage: 5:216/223 of query aligns to 2:210/210 of 2fuaA
1dzuP L-fuculose-1-phosphate aldolase from escherichia coli mutant t26a (see paper)
51% identity, 95% coverage: 5:215/223 of query aligns to 2:209/209 of 1dzuP
4fuaA L-fuculose-1-phosphate aldolase complex with pgh (see paper)
51% identity, 93% coverage: 5:212/223 of query aligns to 2:206/206 of 4fuaA
- active site: E73 (= E80), H92 (= H99), H94 (= H101), Y113 (= Y120), A117 (= A124), H155 (= H162)
- binding phosphoglycolohydroxamic acid: G28 (= G31), N29 (= N32), T43 (≠ S46), S71 (= S78), S72 (= S79), E73 (= E80), H92 (= H99), H94 (= H101), H155 (= H162)
- binding zinc ion: H92 (= H99), H94 (= H101), H155 (= H162)
7x78A L-fuculose 1-phosphate aldolase (see paper)
50% identity, 91% coverage: 9:212/223 of query aligns to 6:203/203 of 7x78A
Sites not aligning to the query:
P0DTQ0 5-deoxy-D-ribulose 1-phosphate aldolase; 5-deoxyribose disposal aldolase; EC 4.1.2.- from Bacillus thuringiensis serovar kurstaki (strain ATCC 35866 / NRRL B-4488 / HD73) (see paper)
39% identity, 93% coverage: 10:217/223 of query aligns to 7:212/213 of P0DTQ0
- E76 (= E80) binding
- H95 (= H99) binding
- H97 (= H101) binding
- H157 (= H162) binding
6btgA Crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis (see paper)
39% identity, 91% coverage: 10:212/223 of query aligns to 7:207/207 of 6btgA
4c25A L-fuculose 1-phosphate aldolase (see paper)
40% identity, 91% coverage: 11:213/223 of query aligns to 18:211/212 of 4c25A
Q58813 L-fuculose phosphate aldolase; L-fuculose-1-phosphate aldolase; EC 4.1.2.17 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
31% identity, 72% coverage: 28:187/223 of query aligns to 21:169/181 of Q58813
- N25 (= N32) mutation to L: It shows a 3-fold increase of the affinty for dihydroxyacetone phosphate (DHAP) and a 3-fold decrease of the affinity for DL-glyceraldehyde compared to the wild-type.; mutation to T: It shows a 5-fold decrease of the affinty for dihydroxyacetone phosphate (DHAP), but has the same affinity for DL-glyceraldehyde compared to the wild-type.
6voqA Crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae
31% identity, 81% coverage: 6:186/223 of query aligns to 4:185/207 of 6voqA
P08203 L-ribulose-5-phosphate 4-epimerase AraD; Phosphoribulose isomerase; EC 5.1.3.4 from Escherichia coli (strain K12) (see 4 papers)
34% identity, 49% coverage: 9:117/223 of query aligns to 5:113/231 of P08203
- N28 (= N32) mutation to A: Strong decrease of the affinity for L-ribulose 5-phosphate (LRu5P).
- K42 (≠ T44) mutation to M: Strong decrease of the affinity for L-ribulose 5-phosphate (LRu5P).
- D76 (≠ E80) mutation to N: Mutant shows a strong decrease of the catalytic efficiency, but it retains considerable epimerase activity. The affinity for L-ribulose 5-phosphate (LRu5P) is relatively unaffected.
- H95 (= H99) binding ; mutation to N: Mutant shows a strong decrease of the catalytic efficiency and a reduced affinity for Zn(2+).
- H97 (= H101) binding ; mutation to N: Mutant shows a strong decrease of the catalytic efficiency and a reduced affinity for Zn(2+). Inhibited by glycolaldehyde phosphate.
Sites not aligning to the query:
- 116 mutation T->E,Y: Loss of the epimerase activity due to an increased steric bulk introduced by the mutation which causes a conformational change that is incompatible with catalysis.
- 120 D→N: Loss of the epimerase activity.
- 142 E→Q: Mutant shows a strong decrease of the catalytic efficiency, but it retains considerable epimerase activity. The affinity for L-ribulose 5-phosphate (LRu5P) is relatively unaffected.
- 171 binding
- 218 H→N: Mutant shows a strong decrease of the catalytic efficiency, but it retains considerable epimerase activity. The affinity for L-ribulose 5-phosphate (LRu5P) is relatively unaffected.
- 229 Y→F: Loss of the epimerase activity.
1jdiA Crystal structure of l-ribulose-5-phosphate 4-epimerase (see paper)
34% identity, 49% coverage: 9:117/223 of query aligns to 5:113/223 of 1jdiA
Sites not aligning to the query:
8il8A Crystal structure of pyruvic oxime dioxygenase (pod) from alcaligenes faecalis
31% identity, 56% coverage: 63:186/223 of query aligns to 54:179/230 of 8il8A
4xxfA L-fuculose 1-phosphate aldolase from glaciozyma antarctica pi12 (see paper)
26% identity, 69% coverage: 24:177/223 of query aligns to 37:188/249 of 4xxfA
Query Sequence
>H281DRAFT_02706 FitnessBrowser__Burk376:H281DRAFT_02706
MKAAQERALRRGIVETSLEMERLGINQGTSGNVSARLGEGFLITPSGVPARELREEGIVW
LPLDVDDDAEVLHVKRPSSEWRIHRDILRARHEMHAVVHTHSTAATAMAIHGRDIPALHY
MVAAAGGDSIRCAPYALFGTQLLSDHALKALQDRRACLLAHHGVVALGDDLARAVWLAHE
VEVLARQYLLACQLGPPPLLSDVQMEEVLERFKTYGRPRHAER
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory