Comparing H281DRAFT_02712 FitnessBrowser__Burk376:H281DRAFT_02712 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
45% identity, 98% coverage: 9:503/505 of query aligns to 4:491/501 of P04983
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
34% identity, 44% coverage: 8:230/505 of query aligns to 3:226/648 of P75831
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 43% coverage: 8:224/505 of query aligns to 16:225/378 of P69874
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 48% coverage: 12:254/505 of query aligns to 6:250/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 48% coverage: 12:254/505 of query aligns to 6:250/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 48% coverage: 12:254/505 of query aligns to 6:250/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 48% coverage: 12:254/505 of query aligns to 6:250/353 of Q97UY8
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
31% identity, 44% coverage: 8:228/505 of query aligns to 3:218/218 of 7w78A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 43% coverage: 10:226/505 of query aligns to 5:229/254 of 1g6hA
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
31% identity, 43% coverage: 8:226/505 of query aligns to 3:216/216 of 7w79A
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 43% coverage: 10:226/505 of query aligns to 5:229/253 of 1g9xB
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
29% identity, 43% coverage: 10:227/505 of query aligns to 4:218/223 of 2pclA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 47% coverage: 8:243/505 of query aligns to 1:240/241 of 4u00A
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
26% identity, 62% coverage: 10:322/505 of query aligns to 4:304/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
26% identity, 62% coverage: 10:322/505 of query aligns to 4:304/615 of 5lilA
7ph2A Nanodisc reconstituted msba in complex with nanobodies, spin-labeled at position a60c (see paper)
34% identity, 42% coverage: 10:223/505 of query aligns to 331:543/569 of 7ph2A
Sites not aligning to the query:
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
29% identity, 44% coverage: 9:230/505 of query aligns to 4:226/650 of 5ws4A
6bppA E. Coli msba in complex with lps and inhibitor g092 (see paper)
33% identity, 42% coverage: 10:223/505 of query aligns to 339:551/576 of 6bppA
Sites not aligning to the query:
6bplA E. Coli msba in complex with lps and inhibitor g907 (see paper)
33% identity, 42% coverage: 10:223/505 of query aligns to 339:551/576 of 6bplA
Sites not aligning to the query:
P60752 ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA; Lipid flippase; EC 7.5.2.6 from Escherichia coli (strain K12) (see 7 papers)
34% identity, 42% coverage: 10:223/505 of query aligns to 342:554/582 of P60752
Sites not aligning to the query:
>H281DRAFT_02712 FitnessBrowser__Burk376:H281DRAFT_02712
MSHVTGVPFLEMRNISRTFPGVKALDRVNLEIRAGEVLALAGENGAGKSTLMKILTGIYA
PDPGGTILVEGQEVALADSHHARTLGVNIIYQELAVVGNLTVGENIFLAREPRTRLGLID
RPRMYREAREVLATIDMDIDPATRVSELSVGQQQMIEIAKALCARSKAIIMDEPTASLSH
HETSVLLGIVKRLRERNIAVVYISHRLEEIFELADRVTVLRDGRTVGTAPIADMTRETLV
RLMVARELSELYGEPQSHASRDPVLEVRALSLKPVRKAEPRIRDISFTLHRGEVLGIAGL
VGSGRTEIMEMIFGMRACTGSVKIEGKPVSIRNPHDAIRSGIGFVTEDRKAQGLILGMTV
RENFSLTHLERYSPFQFVQHARERESCRRFVRMLGIKTPGVEQKVVNLSGGNQQKIVIAK
WVARSPKVLIVDEPTRGIDVGAKAEVHALIARLAAEGIGVIVISSDLLEVLAVSDRILTV
REGRISGELSRAQASQEKVMALATA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory