Comparing H281DRAFT_02725 FitnessBrowser__Burk376:H281DRAFT_02725 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
27% identity, 45% coverage: 34:227/429 of query aligns to 54:229/444 of Q8NLB7
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 53% coverage: 7:232/429 of query aligns to 25:260/583 of Q9Y7Q9
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 76% coverage: 54:380/429 of query aligns to 173:501/616 of P36035
Sites not aligning to the query:
>H281DRAFT_02725 FitnessBrowser__Burk376:H281DRAFT_02725
MSTDTAAMQQPLDAAQSHNIARLIVATSIGNALEFYDLVVYGYFASTLSRLFFPTHDRTV
SLLLTLGTFALSYLARPVGALVLGSYSDRHGRKASLTLSIGLMTLGTGLVAVMPPYATIG
IAAPILIFLSRLLQGFSAGGEFGSSTAFLVEHAPARSGFMSSWQFSSQGASTLLASLFGA
LLTGLLTPPQLEGWGWRIPFLFGMLIGPIGLYIRRRMDETPEFARAEKLASPVRVVLATQ
KERVLVSIGSLVLTTTANYMLLYMPTYATHQLKLSPSSGFIATLVAGFIMMALVPVVGHL
SDKLGRIRIMLPVGVLFLVTVYPAFMLMNAYPSLPMLLACVIWVALLKATYFAPIPALMA
DLFPVETRTTGMAFAYNIGTTIFGGFTPVVVAALIAFTHNNLAPGLYLMIAAVISLFTLM
WARRRLHVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory