Comparing H281DRAFT_02738 FitnessBrowser__Burk376:H281DRAFT_02738 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
Q8PHA1 Molybdate-binding protein ModA; Molybdate/tungstate-binding protein ModA from Xanthomonas axonopodis pv. citri (strain 306) (see 2 papers)
26% identity, 96% coverage: 8:259/262 of query aligns to 6:254/258 of Q8PHA1
2h5yB Crystallographic structure of the molybdate-binding protein of xanthomonas citri at 1.7 ang resolution bound to molybdate (see paper)
27% identity, 88% coverage: 30:259/262 of query aligns to 3:230/233 of 2h5yB
2h5yA Crystallographic structure of the molybdate-binding protein of xanthomonas citri at 1.7 ang resolution bound to molybdate (see paper)
27% identity, 88% coverage: 30:259/262 of query aligns to 2:229/232 of 2h5yA
>H281DRAFT_02738 FitnessBrowser__Burk376:H281DRAFT_02738
MIVNNANFLRAALSAALLSGALISTAVHAADVHVLATGALSAAFRELGPGYERQTGNHLI
ISWGPSYGTSADALPMRIRNGEAMDVCLMIRPALDEQISQGKFLPDTRTDLVASRIGVAV
QAGMPKPDVSTVDKLRNALLTAKSVAFSEGASGTYITGTLFPRLGIAHQMNARSVQIKGK
ELVGTAIERGDAELGLQQISELRAIQGIQYVGPLPEEVQKASVVSAAVSTSAQEREGAAA
LISYLKTPAASAVFEKTGLDPI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory